Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP05_F_F08
         (870 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.          24   1.8  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    23   4.1  

>DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.
          Length = 822

 Score = 23.8 bits (49), Expect = 1.8
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +3

Query: 741 PPPPPPP 761
           PPPPPPP
Sbjct: 731 PPPPPPP 737



 Score = 23.8 bits (49), Expect = 1.8
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +2

Query: 743 PPPPPPP 763
           PPPPPPP
Sbjct: 731 PPPPPPP 737



 Score = 23.8 bits (49), Expect = 1.8
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +1

Query: 745 PPPPPPP 765
           PPPPPPP
Sbjct: 731 PPPPPPP 737


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 10/34 (29%), Positives = 13/34 (38%)
 Frame = -1

Query: 300  PPXGAPPGFXKTPNPXFXXFKXXVFKKNWAGLKK 199
            PP    P   +   P    FK   +  NWA  +K
Sbjct: 1379 PPTSEKPPLPEELKPQSGYFKIVCYFTNWAWYRK 1412


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 159,012
Number of Sequences: 336
Number of extensions: 3666
Number of successful extensions: 22
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 23996456
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)