BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP05_F_B09
(910 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPBC28E12.05 |esf2|SPBC3H7.17c|U3 snoRNP-associated protein Esf2... 27 2.8
>SPBC28E12.05 |esf2|SPBC3H7.17c|U3 snoRNP-associated protein Esf2
|Schizosaccharomyces pombe|chr 2|||Manual
Length = 334
Score = 27.5 bits (58), Expect = 2.8
Identities = 15/65 (23%), Positives = 26/65 (40%)
Frame = +2
Query: 182 RYHGESHFKPPTMDELPVPKGSWQSHHDANQRRFNAVLLFGIXXXXXXXXXXKTSGLVYL 361
R+ +S F+ T D GS + + N++ + K SG++YL
Sbjct: 67 RFRRDSTFESETSDHEDFSGGSENELDEETTKNANSIKKISLEEVEKQRKAIKRSGVIYL 126
Query: 362 NYSPP 376
+ PP
Sbjct: 127 SRIPP 131
Database: spombe
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,443,604
Number of Sequences: 5004
Number of extensions: 36193
Number of successful extensions: 92
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 89
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 92
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 460503700
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -