BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP04_F_P09
(941 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Z82080-4|CAC70117.1| 1125|Caenorhabditis elegans Hypothetical pr... 29 4.8
>Z82080-4|CAC70117.1| 1125|Caenorhabditis elegans Hypothetical protein
W09G3.6 protein.
Length = 1125
Score = 29.1 bits (62), Expect = 4.8
Identities = 14/48 (29%), Positives = 23/48 (47%)
Frame = +1
Query: 589 RLRPPXRASQKSTLKSEVAKPDRTIKIPGVSPWKLPRALSCPTCRLRI 732
R +PP A+ +T +V P+ + P +S W + CP C L +
Sbjct: 1012 RGKPPPTAAA-ATSSRKVTSPNGSAPAPSISSWIVDTNGKCPMCTLPV 1058
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,230,070
Number of Sequences: 27780
Number of extensions: 299859
Number of successful extensions: 683
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 660
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 683
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2433684176
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -