BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP04_F_L09
(893 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPCC1682.08c |||RNA-binding protein Mcp2|Schizosaccharomyces pom... 26 6.3
SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr ... 26 8.3
>SPCC1682.08c |||RNA-binding protein Mcp2|Schizosaccharomyces
pombe|chr 3|||Manual
Length = 703
Score = 26.2 bits (55), Expect = 6.3
Identities = 13/39 (33%), Positives = 19/39 (48%)
Frame = -3
Query: 204 KQHRRTLRLKTGMRWRFPNVSCPHEPFLIALGTFLVGNR 88
K H ++T +R+ S P P + LGT+ V NR
Sbjct: 235 KSHNSLPSIRTNVRYSNSKPSTPLSPEDVDLGTYTVKNR 273
>SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr
1|||Manual
Length = 1854
Score = 25.8 bits (54), Expect = 8.3
Identities = 7/13 (53%), Positives = 9/13 (69%)
Frame = +1
Query: 127 WFVWARNIWKSPP 165
W VWA +W +PP
Sbjct: 1129 WEVWAPRVWSNPP 1141
Database: spombe
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,364,050
Number of Sequences: 5004
Number of extensions: 35901
Number of successful extensions: 64
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 63
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 64
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 450492750
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -