SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP04_F_L09
         (893 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC1682.08c |||RNA-binding protein Mcp2|Schizosaccharomyces pom...    26   6.3  
SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr ...    26   8.3  

>SPCC1682.08c |||RNA-binding protein Mcp2|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 703

 Score = 26.2 bits (55), Expect = 6.3
 Identities = 13/39 (33%), Positives = 19/39 (48%)
 Frame = -3

Query: 204 KQHRRTLRLKTGMRWRFPNVSCPHEPFLIALGTFLVGNR 88
           K H     ++T +R+     S P  P  + LGT+ V NR
Sbjct: 235 KSHNSLPSIRTNVRYSNSKPSTPLSPEDVDLGTYTVKNR 273


>SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1854

 Score = 25.8 bits (54), Expect = 8.3
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +1

Query: 127  WFVWARNIWKSPP 165
            W VWA  +W +PP
Sbjct: 1129 WEVWAPRVWSNPP 1141


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,364,050
Number of Sequences: 5004
Number of extensions: 35901
Number of successful extensions: 64
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 63
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 64
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 450492750
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -