SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP04_F_H24
         (889 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ419879-1|CAD12039.1|   34|Anopheles gambiae hypothetical prote...    26   1.8  
AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific tran...    25   3.1  
AY785360-1|AAV52864.1|  759|Anopheles gambiae male-specific tran...    25   3.1  
AY725820-1|AAU50568.1|  593|Anopheles gambiae fruitless female-s...    25   3.1  

>AJ419879-1|CAD12039.1|   34|Anopheles gambiae hypothetical protein
           protein.
          Length = 34

 Score = 25.8 bits (54), Expect = 1.8
 Identities = 15/32 (46%), Positives = 18/32 (56%)
 Frame = +1

Query: 214 ISLSTSIVFVFRVSRSLFIKQTVYPRTRYK*C 309
           IS  T  +F+  VS SL I   V PR RY+ C
Sbjct: 4   ISRVTPFLFIC-VSSSLVISSKVKPRARYQAC 34


>AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific
           transcription factor FRU-MA protein.
          Length = 960

 Score = 25.0 bits (52), Expect = 3.1
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = -1

Query: 409 QTHPEYRHQKPTH 371
           Q HP  +HQ+PTH
Sbjct: 268 QQHPSSQHQQPTH 280


>AY785360-1|AAV52864.1|  759|Anopheles gambiae male-specific
           transcription factor FRU-MB protein.
          Length = 759

 Score = 25.0 bits (52), Expect = 3.1
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = -1

Query: 409 QTHPEYRHQKPTH 371
           Q HP  +HQ+PTH
Sbjct: 268 QQHPSSQHQQPTH 280


>AY725820-1|AAU50568.1|  593|Anopheles gambiae fruitless
           female-specific zinc-fingerC isoform protein.
          Length = 593

 Score = 25.0 bits (52), Expect = 3.1
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = -1

Query: 409 QTHPEYRHQKPTH 371
           Q HP  +HQ+PTH
Sbjct: 220 QQHPSSQHQQPTH 232


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 908,949
Number of Sequences: 2352
Number of extensions: 19791
Number of successful extensions: 29
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 29
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 95507181
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -