Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP04_F_B04
         (978 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac...    26   7.0  
SPCC320.06 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||...    26   7.0  
SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||...    26   9.3  

>SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit
           Spp42|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 2363

 Score = 26.2 bits (55), Expect = 7.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +1

Query: 892 PGGPPPPPP 918
           PG PPPPPP
Sbjct: 6   PGNPPPPPP 14


>SPCC320.06 |||sequence orphan|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 289

 Score = 26.2 bits (55), Expect = 7.0
 Identities = 12/32 (37%), Positives = 16/32 (50%)
 Frame = -2

Query: 206 PGAXAFXDYWGXLCTKGLPIYNTKLKIMNTKL 111
           P A AF  YW  L      IY T  +I++ K+
Sbjct: 227 PKATAFARYWMHLICSYYGIYTTSTQILSNKI 258


>SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 1461

 Score = 25.8 bits (54), Expect = 9.3
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +1

Query: 895 GGPPPPPP 918
           GGPPPPPP
Sbjct: 759 GGPPPPPP 766


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,037,565
Number of Sequences: 5004
Number of extensions: 26080
Number of successful extensions: 66
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 29
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 54
length of database: 2,362,478
effective HSP length: 73
effective length of database: 1,997,186
effective search space used: 503290872
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)