SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP03_F_P01
         (956 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ010193-1|CAA09032.1|  684|Anopheles gambiae prophenoloxidase p...    25   3.4  
AY578795-1|AAT07300.1|  441|Anopheles gambiae Gbb-60A2 protein.        24   5.9  
AY146752-1|AAO12067.1|  277|Anopheles gambiae odorant-binding pr...    24   5.9  
AY146751-1|AAO12066.1|  277|Anopheles gambiae odorant-binding pr...    24   5.9  
AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr...    24   5.9  
EF519478-1|ABP73565.1|  165|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519477-1|ABP73563.1|  165|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519476-1|ABP73561.1|  165|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519475-1|ABP73559.1|  165|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519474-1|ABP73557.1|  165|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519473-1|ABP73555.1|  165|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519471-1|ABP73551.1|  165|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519470-1|ABP73549.1|  165|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519469-1|ABP73547.1|  165|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519468-1|ABP73545.1|  165|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519467-1|ABP73543.1|  165|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519466-1|ABP73541.1|  165|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519465-1|ABP73539.1|  165|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519464-1|ABP73537.1|  160|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519463-1|ABP73535.1|  162|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519462-1|ABP73533.1|  147|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519461-1|ABP73531.1|  147|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519460-1|ABP73529.1|  157|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519459-1|ABP73527.1|  157|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519458-1|ABP73525.1|  165|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519457-1|ABP73523.1|  165|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519456-1|ABP73521.1|  165|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519455-1|ABP73519.1|  163|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519454-1|ABP73517.1|  164|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519453-1|ABP73515.1|  163|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519452-1|ABP73513.1|  165|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519451-1|ABP73511.1|  151|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519450-1|ABP73509.1|  151|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519449-1|ABP73507.1|  165|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519448-1|ABP73505.1|  151|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519447-1|ABP73503.1|  165|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519446-1|ABP73501.1|  165|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519445-1|ABP73499.1|  165|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519444-1|ABP73497.1|  154|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519443-1|ABP73495.1|  165|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519442-1|ABP73493.1|  162|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519441-1|ABP73491.1|  174|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519440-1|ABP73489.1|  174|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519439-1|ABP73487.1|  174|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519438-1|ABP73485.1|  164|Anopheles gambiae CTLMA2 protein.          24   7.8  
EF519437-1|ABP73483.1|  147|Anopheles gambiae CTLMA2 protein.          24   7.8  

>AJ010193-1|CAA09032.1|  684|Anopheles gambiae prophenoloxidase
           protein.
          Length = 684

 Score = 25.0 bits (52), Expect = 3.4
 Identities = 8/19 (42%), Positives = 12/19 (63%)
 Frame = +2

Query: 365 WFTNVFLPKGYPDSVSRDY 421
           W  ++ LPKG PD +  D+
Sbjct: 583 WPNHMLLPKGSPDGIEYDF 601


>AY578795-1|AAT07300.1|  441|Anopheles gambiae Gbb-60A2 protein.
          Length = 441

 Score = 24.2 bits (50), Expect = 5.9
 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 3/32 (9%)
 Frame = +3

Query: 69  GTPDNPSPAYPEPELKSSRP-FLENF--KFSQ 155
           G PD P+  +  P L+ S P FL N   KF++
Sbjct: 58  GLPDRPNKQHVHPSLRKSAPQFLLNIYHKFTE 89


>AY146752-1|AAO12067.1|  277|Anopheles gambiae odorant-binding
           protein AgamOBP35 protein.
          Length = 277

 Score = 24.2 bits (50), Expect = 5.9
 Identities = 9/23 (39%), Positives = 13/23 (56%)
 Frame = -2

Query: 553 CHCCSEWSSSCISNTNTSKHFLS 485
           C   ++  S C  NT+  KHFL+
Sbjct: 243 CEHATDVFSQCFGNTDLYKHFLA 265


>AY146751-1|AAO12066.1|  277|Anopheles gambiae odorant-binding
           protein AgamOBP36 protein.
          Length = 277

 Score = 24.2 bits (50), Expect = 5.9
 Identities = 9/23 (39%), Positives = 13/23 (56%)
 Frame = -2

Query: 553 CHCCSEWSSSCISNTNTSKHFLS 485
           C   ++  S C  NT+  KHFL+
Sbjct: 243 CEHATDVFSQCFGNTDLYKHFLA 265


>AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase
           protein.
          Length = 1253

 Score = 24.2 bits (50), Expect = 5.9
 Identities = 12/34 (35%), Positives = 18/34 (52%)
 Frame = +2

Query: 338 ETKINYFRNWFTNVFLPKGYPDSVSRDYSAYQIW 439
           E +INY  +W  +V L  G  +++S   S  Q W
Sbjct: 861 EKQINYLPDWLYDVDLKNGDTETISA--SEEQFW 892


>EF519478-1|ABP73565.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 144 YEWNDFQCTQQK 155


>EF519477-1|ABP73563.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 144 YEWNDFQCTQQK 155


>EF519476-1|ABP73561.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 144 YEWNDFQCTQQK 155


>EF519475-1|ABP73559.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 144 YEWNDFQCTQQK 155


>EF519474-1|ABP73557.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 144 YEWNDFQCTQQK 155


>EF519473-1|ABP73555.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 144 YEWNDFQCTQQK 155


>EF519471-1|ABP73551.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 144 YEWNDFQCTQQK 155


>EF519470-1|ABP73549.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 144 YEWNDFQCTQQK 155


>EF519469-1|ABP73547.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 144 YEWNDFQCTQQK 155


>EF519468-1|ABP73545.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 144 YEWNDFQCTQQK 155


>EF519467-1|ABP73543.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 144 YEWNDFQCTQQK 155


>EF519466-1|ABP73541.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 144 YEWNDFQCTQQK 155


>EF519465-1|ABP73539.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 144 YEWNDFQCTQQK 155


>EF519464-1|ABP73537.1|  160|Anopheles gambiae CTLMA2 protein.
          Length = 160

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 139 YEWNDFQCTQQK 150


>EF519463-1|ABP73535.1|  162|Anopheles gambiae CTLMA2 protein.
          Length = 162

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 141 YEWNDFQCTQQK 152


>EF519462-1|ABP73533.1|  147|Anopheles gambiae CTLMA2 protein.
          Length = 147

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 126 YEWNDFQCTQQK 137


>EF519461-1|ABP73531.1|  147|Anopheles gambiae CTLMA2 protein.
          Length = 147

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 126 YEWNDFQCTQQK 137


>EF519460-1|ABP73529.1|  157|Anopheles gambiae CTLMA2 protein.
          Length = 157

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 136 YEWNDFQCTQQK 147


>EF519459-1|ABP73527.1|  157|Anopheles gambiae CTLMA2 protein.
          Length = 157

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 136 YEWNDFQCTQQK 147


>EF519458-1|ABP73525.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 144 YEWNDFQCTQQK 155


>EF519457-1|ABP73523.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 144 YEWNDFQCTQQK 155


>EF519456-1|ABP73521.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 144 YEWNDFQCTQQK 155


>EF519455-1|ABP73519.1|  163|Anopheles gambiae CTLMA2 protein.
          Length = 163

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 142 YEWNDFQCTQQK 153


>EF519454-1|ABP73517.1|  164|Anopheles gambiae CTLMA2 protein.
          Length = 164

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 143 YEWNDFQCTQQK 154


>EF519453-1|ABP73515.1|  163|Anopheles gambiae CTLMA2 protein.
          Length = 163

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 142 YEWNDFQCTQQK 153


>EF519452-1|ABP73513.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 144 YEWNDFQCTQQK 155


>EF519451-1|ABP73511.1|  151|Anopheles gambiae CTLMA2 protein.
          Length = 151

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 130 YEWNDFQCTQQK 141


>EF519450-1|ABP73509.1|  151|Anopheles gambiae CTLMA2 protein.
          Length = 151

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 130 YEWNDFQCTQQK 141


>EF519449-1|ABP73507.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 144 YEWNDFQCTQQK 155


>EF519448-1|ABP73505.1|  151|Anopheles gambiae CTLMA2 protein.
          Length = 151

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 130 YEWNDFQCTQQK 141


>EF519447-1|ABP73503.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 144 YEWNDFQCTQQK 155


>EF519446-1|ABP73501.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 144 YEWNDFQCTQQK 155


>EF519445-1|ABP73499.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 144 YEWNDFQCTQQK 155


>EF519444-1|ABP73497.1|  154|Anopheles gambiae CTLMA2 protein.
          Length = 154

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 133 YEWNDFQCTQQK 144


>EF519443-1|ABP73495.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 144 YEWNDFQCTQQK 155


>EF519442-1|ABP73493.1|  162|Anopheles gambiae CTLMA2 protein.
          Length = 162

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 141 YEWNDFQCTQQK 152


>EF519441-1|ABP73491.1|  174|Anopheles gambiae CTLMA2 protein.
          Length = 174

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 153 YEWNDFQCTQQK 164


>EF519440-1|ABP73489.1|  174|Anopheles gambiae CTLMA2 protein.
          Length = 174

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 153 YEWNDFQCTQQK 164


>EF519439-1|ABP73487.1|  174|Anopheles gambiae CTLMA2 protein.
          Length = 174

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 153 YEWNDFQCTQQK 164


>EF519438-1|ABP73485.1|  164|Anopheles gambiae CTLMA2 protein.
          Length = 164

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 143 YEWNDFQCTQQK 154


>EF519437-1|ABP73483.1|  147|Anopheles gambiae CTLMA2 protein.
          Length = 147

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 604 YSWNVFGCVQQK 639
           Y WN F C QQK
Sbjct: 126 YEWNDFQCTQQK 137


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 765,679
Number of Sequences: 2352
Number of extensions: 16267
Number of successful extensions: 74
Number of sequences better than 10.0: 46
Number of HSP's better than 10.0 without gapping: 72
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 74
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 105016554
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -