SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP03_F_M02
         (954 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A3FPP3 Cluster: FALZ protein; n=2; Cryptosporidium|Rep:...    37   0.66 

>UniRef50_A3FPP3 Cluster: FALZ protein; n=2; Cryptosporidium|Rep:
           FALZ protein - Cryptosporidium parvum Iowa II
          Length = 1782

 Score = 37.1 bits (82), Expect = 0.66
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 3/64 (4%)
 Frame = -2

Query: 437 VIKVNF--LVNIRRTLISXXXXXXXXX*GSLVPSSIRSHPR-PLIPNSLYSTGSSIPLDN 267
           +IKVNF  L+N+ ++ I+           S++P+S    P  P + ++LY T  + P  N
Sbjct: 150 IIKVNFELLINVPKSPITYVIENDNSINISIIPNSHSKLPWFPTLSSALYLTEDASPFWN 209

Query: 266 SPWS 255
           SPWS
Sbjct: 210 SPWS 213


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 415,574,424
Number of Sequences: 1657284
Number of extensions: 5340432
Number of successful extensions: 12721
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 12433
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12712
length of database: 575,637,011
effective HSP length: 101
effective length of database: 408,251,327
effective search space used: 88182286632
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -