BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP03_F_M02
(954 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_A3FPP3 Cluster: FALZ protein; n=2; Cryptosporidium|Rep:... 37 0.66
>UniRef50_A3FPP3 Cluster: FALZ protein; n=2; Cryptosporidium|Rep:
FALZ protein - Cryptosporidium parvum Iowa II
Length = 1782
Score = 37.1 bits (82), Expect = 0.66
Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 3/64 (4%)
Frame = -2
Query: 437 VIKVNF--LVNIRRTLISXXXXXXXXX*GSLVPSSIRSHPR-PLIPNSLYSTGSSIPLDN 267
+IKVNF L+N+ ++ I+ S++P+S P P + ++LY T + P N
Sbjct: 150 IIKVNFELLINVPKSPITYVIENDNSINISIIPNSHSKLPWFPTLSSALYLTEDASPFWN 209
Query: 266 SPWS 255
SPWS
Sbjct: 210 SPWS 213
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 415,574,424
Number of Sequences: 1657284
Number of extensions: 5340432
Number of successful extensions: 12721
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 12433
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12712
length of database: 575,637,011
effective HSP length: 101
effective length of database: 408,251,327
effective search space used: 88182286632
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -