SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP03_F_I11
         (936 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667195-1|ABG75747.1|  469|Apis mellifera cys-loop ligand-gated...    28   0.11 
DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholi...    24   1.7  
DQ485319-1|ABF21078.1|  175|Apis mellifera icarapin variant 2 pr...    22   9.2  
DQ485318-1|ABF21077.1|  223|Apis mellifera icarapin variant 1 pr...    22   9.2  
AY939856-1|AAX33236.1|  223|Apis mellifera venom carbohydrate-ri...    22   9.2  
AY897570-1|AAW81036.1|  223|Apis mellifera venom protein 2 protein.    22   9.2  

>DQ667195-1|ABG75747.1|  469|Apis mellifera cys-loop ligand-gated
           ion channel subunit protein.
          Length = 469

 Score = 28.3 bits (60), Expect = 0.11
 Identities = 18/63 (28%), Positives = 27/63 (42%)
 Frame = -2

Query: 197 WFLNILSFI*FRKVQFLL*INFIKLM*RRKKNIVYHTSKTKYSLCKCMQVKILRIPYSVN 18
           WFL    F+    V+F     F+  + RRKK +      +KY L   +  K+ R  +  N
Sbjct: 297 WFLGCTIFLFAAMVEFA----FVNTIYRRKKTVPLKKVNSKYILKSTLTPKLARKQFQKN 352

Query: 17  XXG 9
             G
Sbjct: 353 TTG 355


>DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholine
           receptor beta1subunit protein.
          Length = 520

 Score = 24.2 bits (50), Expect = 1.7
 Identities = 13/46 (28%), Positives = 27/46 (58%), Gaps = 4/46 (8%)
 Frame = +2

Query: 584 LLVMMTKDLIFTRLVRQPT---TLIVVRWQSEHVRSQRVP-ILRSI 709
           +L ++ K L+FT ++   +   T+I++ W     R+ R+P ++R I
Sbjct: 292 VLPLIAKYLLFTFIMNTVSILVTVIIINWNFRGPRTHRMPQLIRKI 337


>DQ485319-1|ABF21078.1|  175|Apis mellifera icarapin variant 2
           precursor protein.
          Length = 175

 Score = 21.8 bits (44), Expect = 9.2
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -1

Query: 510 DETSNWHWSIM 478
           DE SNW+W+ +
Sbjct: 21  DEGSNWNWNTL 31


>DQ485318-1|ABF21077.1|  223|Apis mellifera icarapin variant 1
           precursor protein.
          Length = 223

 Score = 21.8 bits (44), Expect = 9.2
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -1

Query: 510 DETSNWHWSIM 478
           DE SNW+W+ +
Sbjct: 65  DEGSNWNWNTL 75


>AY939856-1|AAX33236.1|  223|Apis mellifera venom carbohydrate-rich
           protein precursor protein.
          Length = 223

 Score = 21.8 bits (44), Expect = 9.2
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -1

Query: 510 DETSNWHWSIM 478
           DE SNW+W+ +
Sbjct: 65  DEGSNWNWNTL 75


>AY897570-1|AAW81036.1|  223|Apis mellifera venom protein 2 protein.
          Length = 223

 Score = 21.8 bits (44), Expect = 9.2
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -1

Query: 510 DETSNWHWSIM 478
           DE SNW+W+ +
Sbjct: 65  DEGSNWNWNTL 75


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 248,831
Number of Sequences: 438
Number of extensions: 5073
Number of successful extensions: 11
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 30597567
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -