Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP03_F_G21
         (925 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z77665-7|CAI46591.1|  360|Caenorhabditis elegans Hypothetical pr...    33   0.29 

>Z77665-7|CAI46591.1|  360|Caenorhabditis elegans Hypothetical
           protein K02E11.10 protein.
          Length = 360

 Score = 33.1 bits (72), Expect = 0.29
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 3/57 (5%)
 Frame = -2

Query: 837 TYTGXEXPTGXSYEKGPT---FXRREKGGQGIR*XAGSEQGGARGXFXRGETPGXFI 676
           T  G +   G  Y++GP    F  ++   QG++  AG +QG A+G F   + P   +
Sbjct: 170 TLGGGQAQGGAGYQQGPAQGRFVAQQGSAQGVQGGAGYQQGPAQGGFTAQQGPAQVV 226


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,890,547
Number of Sequences: 27780
Number of extensions: 192469
Number of successful extensions: 299
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 278
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 298
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2370744068
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)