BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP03_F_G07
(894 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 27 0.58
>DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2
protein.
Length = 961
Score = 27.5 bits (58), Expect = 0.58
Identities = 16/66 (24%), Positives = 30/66 (45%), Gaps = 2/66 (3%)
Frame = +2
Query: 122 LKMSNCLRSFSHKILPINGIATTKNHSNRLTRKIPMRTQFLEDFLHQ--RRISSCQTASK 295
L S+ + F H P+ + + + R +P+ F F+H+ S Q A+K
Sbjct: 400 LSCSSFFQQFFHCYCPVKFGRKADPNGDYIRRYLPVLKNFPTRFIHEPWNASESVQRAAK 459
Query: 296 CVLEKN 313
C++ K+
Sbjct: 460 CLIGKD 465
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 860,220
Number of Sequences: 2352
Number of extensions: 18100
Number of successful extensions: 30
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 30
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 96334083
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -