BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP03_F_D11
(918 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 24 7.4
AJ441131-4|CAD29633.1| 566|Anopheles gambiae putative apyrase/n... 24 7.4
AJ439398-3|CAD28126.1| 566|Anopheles gambiae putative 5' nucleo... 24 7.4
>CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein.
Length = 1664
Score = 23.8 bits (49), Expect = 7.4
Identities = 14/39 (35%), Positives = 22/39 (56%)
Frame = +3
Query: 276 QDVERGGKIIMPPSALEQLTRLNIEYPMIFKLTNKKSKR 392
+D+E GG+ PP++ +L R + P +KKSKR
Sbjct: 1440 RDMEEGGRQSTPPASPARLARSSPASP----TPSKKSKR 1474
>AJ441131-4|CAD29633.1| 566|Anopheles gambiae putative
apyrase/nucleotidase protein.
Length = 566
Score = 23.8 bits (49), Expect = 7.4
Identities = 9/13 (69%), Positives = 10/13 (76%)
Frame = +1
Query: 202 FTKYLGHLI*LID 240
FTKYLGHL+ D
Sbjct: 305 FTKYLGHLVVYFD 317
>AJ439398-3|CAD28126.1| 566|Anopheles gambiae putative 5'
nucleotidase protein.
Length = 566
Score = 23.8 bits (49), Expect = 7.4
Identities = 9/13 (69%), Positives = 10/13 (76%)
Frame = +1
Query: 202 FTKYLGHLI*LID 240
FTKYLGHL+ D
Sbjct: 305 FTKYLGHLVVYFD 317
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 904,077
Number of Sequences: 2352
Number of extensions: 17575
Number of successful extensions: 23
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 23
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 99641691
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -