BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP03_F_C04
(899 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF043693-5|AAB97532.1| 105|Caenorhabditis elegans Hypothetical ... 44 1e-04
>AF043693-5|AAB97532.1| 105|Caenorhabditis elegans Hypothetical
protein C34B2.10 protein.
Length = 105
Score = 44.0 bits (99), Expect = 1e-04
Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 1/62 (1%)
Frame = +3
Query: 162 KQKQRNYTGXIITLFSIVGFVWGYIVQQFSQSVYXXXXXXXXXXXXTVPPWP-MYRRNPL 338
K +R Y I+T+ I+GF+ G+ QQ S +++ +PPWP ++R+NP+
Sbjct: 25 KVAERTYQ-VILTIAGIIGFLVGFWTQQLSYAMFTVLGASAFTALIILPPWPFLFRKNPI 83
Query: 339 NW 344
W
Sbjct: 84 VW 85
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,464,154
Number of Sequences: 27780
Number of extensions: 219543
Number of successful extensions: 500
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 494
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 500
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2286823924
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -