Bombyx BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP03_F_B02
         (903 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_43576| Best HMM Match : EGF_CA (HMM E-Value=2.7e-38)                29   6.8  

>SB_43576| Best HMM Match : EGF_CA (HMM E-Value=2.7e-38)
          Length = 641

 Score = 28.7 bits (61), Expect = 6.8
 Identities = 19/70 (27%), Positives = 28/70 (40%), Gaps = 5/70 (7%)
 Frame = +1

Query: 541 TLATTTIQFLVKVVIHQHHHFWT*ANFHH*QQEARVTKHPLQH-----PHLRALNPMLVW 705
           T++      ++ +VI+QHHH     N HH   + +  +H   H      H R        
Sbjct: 553 TISIINSMIIINIVINQHHH-QKQQNQHHRHHQKQQNQHHRHHQKKQNQHYRHHQKQQNQ 611

Query: 706 *SSRHRNNQN 735
              RHR  QN
Sbjct: 612 HHHRHRKQQN 621


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,724,738
Number of Sequences: 59808
Number of extensions: 398617
Number of successful extensions: 1070
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 950
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1062
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2597949818
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)