Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP02_F_P19
         (898 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY347952-1|AAR28375.1|  634|Anopheles gambiae putative sulfakini...    25   3.1  
AY028786-1|AAK32960.1|  501|Anopheles gambiae cytochrome P450 pr...    25   4.1  

>AY347952-1|AAR28375.1|  634|Anopheles gambiae putative sulfakinin
           GPCR protein.
          Length = 634

 Score = 25.0 bits (52), Expect = 3.1
 Identities = 11/31 (35%), Positives = 17/31 (54%)
 Frame = -1

Query: 199 SSRLQGAVIVFKYSEGLMRRSGALCGKAGGT 107
           +S + G   +     GL++RSG LC +  GT
Sbjct: 585 NSDMSGNDSLVYVGRGLVQRSGKLCARRSGT 615


>AY028786-1|AAK32960.1|  501|Anopheles gambiae cytochrome P450
           protein.
          Length = 501

 Score = 24.6 bits (51), Expect = 4.1
 Identities = 7/10 (70%), Positives = 10/10 (100%)
 Frame = +3

Query: 99  LPFVPPAFPH 128
           +P+VPP+FPH
Sbjct: 29  VPYVPPSFPH 38


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 578,645
Number of Sequences: 2352
Number of extensions: 10714
Number of successful extensions: 27
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 25
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 96747534
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)