SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP02_F_J15
         (984 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z48367-5|CAE54886.1|  993|Caenorhabditis elegans Hypothetical pr...    32   0.54 
Z48367-4|CAA88324.1| 1110|Caenorhabditis elegans Hypothetical pr...    32   0.54 
Z78013-1|CAB01425.3| 1140|Caenorhabditis elegans Hypothetical pr...    32   0.72 
Z81106-2|CAB03220.2|  468|Caenorhabditis elegans Hypothetical pr...    31   1.3  
U58751-5|AAN84882.1|  781|Caenorhabditis elegans Wasp (actin cyt...    26   1.5  
U58751-4|AAN84881.1|  607|Caenorhabditis elegans Wasp (actin cyt...    26   1.6  
AL110479-9|CAB60315.3|  583|Caenorhabditis elegans Hypothetical ...    25   2.6  
L23646-1|AAA28041.1|  244|Caenorhabditis elegans Hypothetical pr...    25   2.9  
U40799-6|AAA81484.2|  210|Caenorhabditis elegans Ground-like (gr...    29   3.8  
AL132898-14|CAC14406.1| 1641|Caenorhabditis elegans Hypothetical...    29   3.8  
AF003386-9|AAB54259.1| 1621|Caenorhabditis elegans Hypothetical ...    26   4.1  
Z83227-3|CAB05726.2|  241|Caenorhabditis elegans Hypothetical pr...    25   4.8  
Z93393-1|CAB07688.1|  497|Caenorhabditis elegans Hypothetical pr...    28   8.9  
Z82269-5|CAH60772.1|  618|Caenorhabditis elegans Hypothetical pr...    28   8.9  
Z82269-4|CAB70200.2|  633|Caenorhabditis elegans Hypothetical pr...    28   8.9  
Z81135-1|CAB03453.1|  627|Caenorhabditis elegans Hypothetical pr...    28   8.9  
Z81082-3|CAB03095.2|  603|Caenorhabditis elegans Hypothetical pr...    28   8.9  
Z12018-1|CAD88219.2|  774|Caenorhabditis elegans Hypothetical pr...    28   8.9  
Z11126-8|CAD88221.2|  774|Caenorhabditis elegans Hypothetical pr...    28   8.9  
U50310-5|AAA92541.1|  318|Caenorhabditis elegans Ground-like (gr...    28   8.9  
U23515-9|AAP82644.1|  360|Caenorhabditis elegans Hypothetical pr...    28   8.9  
U23515-8|AAP82645.1|  362|Caenorhabditis elegans Hypothetical pr...    28   8.9  
U10438-9|AAU87834.1|  616|Caenorhabditis elegans Hypothetical pr...    28   8.9  
AY438643-1|AAR00670.1|  627|Caenorhabditis elegans abnormal DAue...    28   8.9  
AL021487-15|CAH60766.1|  618|Caenorhabditis elegans Hypothetical...    28   8.9  
AL021487-14|CAA16360.3|  633|Caenorhabditis elegans Hypothetical...    28   8.9  
AF043706-2|AAB97604.2|  730|Caenorhabditis elegans Hypothetical ...    28   8.9  
AC024859-11|AAK29981.1|  933|Caenorhabditis elegans Hypothetical...    28   8.9  
AC024859-10|ABA00158.1|  832|Caenorhabditis elegans Hypothetical...    28   8.9  
AL117204-20|CAB55136.2|  699|Caenorhabditis elegans Hypothetical...    23   9.5  
AJ243905-1|CAB64866.1|  699|Caenorhabditis elegans SF1 protein p...    23   9.5  
AC024847-11|AAO21416.1|  453|Caenorhabditis elegans Ground-like ...    23   9.9  
AF125971-9|AAD14764.1|  442|Caenorhabditis elegans Hypothetical ...    23   9.9  

>Z48367-5|CAE54886.1|  993|Caenorhabditis elegans Hypothetical
           protein C33B4.3b protein.
          Length = 993

 Score = 32.3 bits (70), Expect = 0.54
 Identities = 14/33 (42%), Positives = 14/33 (42%)
 Frame = +2

Query: 884 PPXPPPPPPXXPXXXVXXXXXFXXXXSXSPPPP 982
           PP PPPPPP      V          S  PPPP
Sbjct: 766 PPPPPPPPPHCEPTMVHVEFTPPSTSSVPPPPP 798



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 13/33 (39%), Positives = 14/33 (42%)
 Frame = +2

Query: 884 PPXPPPPPPXXPXXXVXXXXXFXXXXSXSPPPP 982
           PP PPPPPP      +          S  PPPP
Sbjct: 765 PPPPPPPPPPHCEPTMVHVEFTPPSTSSVPPPP 797


>Z48367-4|CAA88324.1| 1110|Caenorhabditis elegans Hypothetical
           protein C33B4.3a protein.
          Length = 1110

 Score = 32.3 bits (70), Expect = 0.54
 Identities = 14/33 (42%), Positives = 14/33 (42%)
 Frame = +2

Query: 884 PPXPPPPPPXXPXXXVXXXXXFXXXXSXSPPPP 982
           PP PPPPPP      V          S  PPPP
Sbjct: 766 PPPPPPPPPHCEPTMVHVEFTPPSTSSVPPPPP 798



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 13/33 (39%), Positives = 14/33 (42%)
 Frame = +2

Query: 884 PPXPPPPPPXXPXXXVXXXXXFXXXXSXSPPPP 982
           PP PPPPPP      +          S  PPPP
Sbjct: 765 PPPPPPPPPPHCEPTMVHVEFTPPSTSSVPPPP 797


>Z78013-1|CAB01425.3| 1140|Caenorhabditis elegans Hypothetical
           protein F15B9.4 protein.
          Length = 1140

 Score = 31.9 bits (69), Expect = 0.72
 Identities = 15/46 (32%), Positives = 16/46 (34%)
 Frame = +2

Query: 773 PPPPXGVXGXXFXXXLPXXLSXXXXXXXXXXXXXXXXPPXPPPPPP 910
           PPPP G+         P  L                 PP PPPPPP
Sbjct: 540 PPPPVGMANGGPPPPPPLPLDLLKGAVAGLKSVPGGPPPPPPPPPP 585


>Z81106-2|CAB03220.2|  468|Caenorhabditis elegans Hypothetical
           protein R06C1.3 protein.
          Length = 468

 Score = 31.1 bits (67), Expect = 1.3
 Identities = 15/48 (31%), Positives = 16/48 (33%)
 Frame = +2

Query: 767 LSPPPPXGVXGXXFXXXLPXXLSXXXXXXXXXXXXXXXXPPXPPPPPP 910
           L PPPP  +        LP                    PP PPPPPP
Sbjct: 319 LPPPPPPLLMNTSIVHQLPAEAPSTIQFVEPSAAPPTNIPPPPPPPPP 366


>U58751-5|AAN84882.1|  781|Caenorhabditis elegans Wasp (actin
           cytoskeleton modulator)homolog protein 1, isoform b
           protein.
          Length = 781

 Score = 26.2 bits (55), Expect(2) = 1.5
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +2

Query: 884 PPXPPPPPP 910
           PP PPPPPP
Sbjct: 609 PPPPPPPPP 617



 Score = 26.2 bits (55), Expect(2) = 1.5
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +2

Query: 884 PPXPPPPPP 910
           PP PPPPPP
Sbjct: 630 PPPPPPPPP 638



 Score = 23.0 bits (47), Expect(2) = 1.5
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +2

Query: 893 PPPPPPXXP 919
           PPPPPP  P
Sbjct: 630 PPPPPPPPP 638



 Score = 23.0 bits (47), Expect(2) = 1.5
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +2

Query: 893 PPPPPPXXP 919
           PPPPPP  P
Sbjct: 649 PPPPPPPPP 657


>U58751-4|AAN84881.1|  607|Caenorhabditis elegans Wasp (actin
           cytoskeleton modulator)homolog protein 1, isoform a
           protein.
          Length = 607

 Score = 26.2 bits (55), Expect(2) = 1.6
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +2

Query: 884 PPXPPPPPP 910
           PP PPPPPP
Sbjct: 435 PPPPPPPPP 443



 Score = 23.0 bits (47), Expect(2) = 1.6
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +2

Query: 893 PPPPPPXXP 919
           PPPPPP  P
Sbjct: 475 PPPPPPPPP 483


>AL110479-9|CAB60315.3|  583|Caenorhabditis elegans Hypothetical
           protein Y105C5B.11 protein.
          Length = 583

 Score = 25.4 bits (53), Expect(2) = 2.6
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +2

Query: 887 PXPPPPPPXXP 919
           P PPPPPP  P
Sbjct: 403 PTPPPPPPVIP 413



 Score = 23.0 bits (47), Expect(2) = 2.6
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +2

Query: 884 PPXPPPPPP 910
           PP P PPPP
Sbjct: 400 PPEPTPPPP 408


>L23646-1|AAA28041.1|  244|Caenorhabditis elegans Hypothetical
           protein F44E2.3 protein.
          Length = 244

 Score = 25.4 bits (53), Expect(2) = 2.9
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +2

Query: 887 PXPPPPPPXXP 919
           P PPPPPP  P
Sbjct: 79  PPPPPPPPSDP 89



 Score = 23.0 bits (47), Expect(2) = 2.9
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +2

Query: 884 PPXPPPPPP 910
           P  PPPPPP
Sbjct: 76  PKLPPPPPP 84


>U40799-6|AAA81484.2|  210|Caenorhabditis elegans Ground-like (grd
           related) protein 4 protein.
          Length = 210

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 12/33 (36%), Positives = 13/33 (39%)
 Frame = +2

Query: 884 PPXPPPPPPXXPXXXVXXXXXFXXXXSXSPPPP 982
           PP PPPPPP      +             PPPP
Sbjct: 28  PPCPPPPPPMCAPPPLPCPPPPICPPQFCPPPP 60



 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 64  PPPPPPPPPMCP 75


>AL132898-14|CAC14406.1| 1641|Caenorhabditis elegans Hypothetical
           protein Y59A8B.1a protein.
          Length = 1641

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 12/32 (37%), Positives = 14/32 (43%)
 Frame = +3

Query: 885 PPXXPXPPPXPPXXXSSXXXXXFXXFXXPPPP 980
           PP    PPP PP   +S     +     PPPP
Sbjct: 176 PPAPIIPPPQPPVMTASAAAAAYRDRLPPPPP 207


>AF003386-9|AAB54259.1| 1621|Caenorhabditis elegans Hypothetical
            protein F59E12.9 protein.
          Length = 1621

 Score = 26.2 bits (55), Expect(2) = 4.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +2

Query: 884  PPXPPPPPP 910
            PP PPPPPP
Sbjct: 1338 PPPPPPPPP 1346



 Score = 21.4 bits (43), Expect(2) = 4.1
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = +2

Query: 887  PXPPPPPPXXP 919
            P PPPPP   P
Sbjct: 1375 PVPPPPPLFSP 1385


>Z83227-3|CAB05726.2|  241|Caenorhabditis elegans Hypothetical
           protein F45B8.3 protein.
          Length = 241

 Score = 25.4 bits (53), Expect(2) = 4.8
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +2

Query: 887 PXPPPPPPXXP 919
           P PPPPPP  P
Sbjct: 88  PLPPPPPPASP 98



 Score = 22.2 bits (45), Expect(2) = 4.8
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +2

Query: 884 PPXPPPPPP 910
           PP P PPPP
Sbjct: 85  PPAPLPPPP 93


>Z93393-1|CAB07688.1|  497|Caenorhabditis elegans Hypothetical
           protein Y48E1B.1 protein.
          Length = 497

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 354 PPAPPPPPPPPP 365



 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 357 PPPPPPPPPPPP 368



 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 358 PPPPPPPPPPPP 369



 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 359 PPPPPPPPPPPP 370



 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 362 PPPPPPPPPQTP 373


>Z82269-5|CAH60772.1|  618|Caenorhabditis elegans Hypothetical
           protein Y45F10B.13b protein.
          Length = 618

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 250 PPPPPPPPPPKP 261


>Z82269-4|CAB70200.2|  633|Caenorhabditis elegans Hypothetical
           protein Y45F10B.13a protein.
          Length = 633

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 265 PPPPPPPPPPKP 276


>Z81135-1|CAB03453.1|  627|Caenorhabditis elegans Hypothetical
           protein W01G7.1 protein.
          Length = 627

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 515 PPLPPPPPPPKP 526


>Z81082-3|CAB03095.2|  603|Caenorhabditis elegans Hypothetical
           protein F42G4.3a protein.
          Length = 603

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 3   PPPPPPPPPLLP 14


>Z12018-1|CAD88219.2|  774|Caenorhabditis elegans Hypothetical
           protein ZK643.8 protein.
          Length = 774

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 303 PPPPPPPPPPAP 314


>Z11126-8|CAD88221.2|  774|Caenorhabditis elegans Hypothetical
           protein ZK643.8 protein.
          Length = 774

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 303 PPPPPPPPPPAP 314


>U50310-5|AAA92541.1|  318|Caenorhabditis elegans Ground-like (grd
           related) protein 9 protein.
          Length = 318

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 137 PPSPPPPPPPPP 148


>U23515-9|AAP82644.1|  360|Caenorhabditis elegans Hypothetical
           protein R144.4a protein.
          Length = 360

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 2   PPPPPPPPPPPP 13



 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 3   PPPPPPPPPPPP 14



 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 4   PPPPPPPPPPPP 15



 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 5   PPPPPPPPPPPP 16



 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 6   PPPPPPPPPPPP 17


>U23515-8|AAP82645.1|  362|Caenorhabditis elegans Hypothetical
           protein R144.4b protein.
          Length = 362

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 2   PPPPPPPPPPPP 13



 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 3   PPPPPPPPPPPP 14



 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 4   PPPPPPPPPPPP 15



 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 5   PPPPPPPPPPPP 16



 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 6   PPPPPPPPPPPP 17


>U10438-9|AAU87834.1|  616|Caenorhabditis elegans Hypothetical
           protein B0280.13 protein.
          Length = 616

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 512 PPPPPPPPPPPP 523


>AY438643-1|AAR00670.1|  627|Caenorhabditis elegans abnormal DAuer
           Formation DAF-5,a Ski oncogene homolog involved in a
           neuronal TGF betapathway (71.0 kD) (daf-5) protein.
          Length = 627

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 515 PPLPPPPPPPKP 526


>AL021487-15|CAH60766.1|  618|Caenorhabditis elegans Hypothetical
           protein Y45F10B.13b protein.
          Length = 618

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 250 PPPPPPPPPPKP 261


>AL021487-14|CAA16360.3|  633|Caenorhabditis elegans Hypothetical
           protein Y45F10B.13a protein.
          Length = 633

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 265 PPPPPPPPPPKP 276


>AF043706-2|AAB97604.2|  730|Caenorhabditis elegans Hypothetical
           protein ZC123.1 protein.
          Length = 730

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 141 PPPPPPPPPPAP 152


>AC024859-11|AAK29981.1|  933|Caenorhabditis elegans Hypothetical
           protein Y71H2AM.15a protein.
          Length = 933

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 791 PPPPPPPPPMLP 802


>AC024859-10|ABA00158.1|  832|Caenorhabditis elegans Hypothetical
           protein Y71H2AM.15b protein.
          Length = 832

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 884 PPXPPPPPPXXP 919
           PP PPPPPP  P
Sbjct: 690 PPPPPPPPPMLP 701


>AL117204-20|CAB55136.2|  699|Caenorhabditis elegans Hypothetical
           protein Y116A8C.32 protein.
          Length = 699

 Score = 23.4 bits (48), Expect(2) = 9.5
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +2

Query: 884 PPXPPPPP 907
           PP PPPPP
Sbjct: 674 PPPPPPPP 681



 Score = 23.0 bits (47), Expect(2) = 9.5
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +2

Query: 893 PPPPPPXXP 919
           PPPPPP  P
Sbjct: 675 PPPPPPPMP 683


>AJ243905-1|CAB64866.1|  699|Caenorhabditis elegans SF1 protein
           protein.
          Length = 699

 Score = 23.4 bits (48), Expect(2) = 9.5
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +2

Query: 884 PPXPPPPP 907
           PP PPPPP
Sbjct: 674 PPPPPPPP 681



 Score = 23.0 bits (47), Expect(2) = 9.5
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +2

Query: 893 PPPPPPXXP 919
           PPPPPP  P
Sbjct: 675 PPPPPPPMP 683


>AC024847-11|AAO21416.1|  453|Caenorhabditis elegans Ground-like
           (grd related) protein16, isoform b protein.
          Length = 453

 Score = 23.4 bits (48), Expect(2) = 9.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +2

Query: 884 PPXPPPPP 907
           PP PPPPP
Sbjct: 63  PPPPPPPP 70



 Score = 23.0 bits (47), Expect(2) = 9.9
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +2

Query: 893 PPPPPPXXP 919
           PPPPPP  P
Sbjct: 64  PPPPPPPAP 72


>AF125971-9|AAD14764.1|  442|Caenorhabditis elegans Hypothetical
           protein Y4C6B.1 protein.
          Length = 442

 Score = 23.4 bits (48), Expect(2) = 9.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +2

Query: 884 PPXPPPPP 907
           PP PPPPP
Sbjct: 315 PPPPPPPP 322



 Score = 23.0 bits (47), Expect(2) = 9.9
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +2

Query: 893 PPPPPPXXP 919
           PPPPPP  P
Sbjct: 316 PPPPPPPLP 324


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,473,451
Number of Sequences: 27780
Number of extensions: 221175
Number of successful extensions: 3460
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 714
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2515
length of database: 12,740,198
effective HSP length: 82
effective length of database: 10,462,238
effective search space used: 2563248310
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -