SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP02_F_F14
         (939 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren...    27   1.1  
AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different...    24   5.8  
DQ655702-1|ABG45862.1|  889|Anopheles gambiae Jxc1 protein.            24   7.6  
CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel...    24   7.6  
AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific tran...    24   7.6  
AY785360-1|AAV52864.1|  759|Anopheles gambiae male-specific tran...    24   7.6  
AY725820-1|AAU50568.1|  593|Anopheles gambiae fruitless female-s...    24   7.6  
AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein.          24   7.6  
AJ439060-12|CAD27763.1|  450|Anopheles gambiae putative tachykin...    24   7.6  
AJ438610-4|CAD27476.1|  593|Anopheles gambiae putative transcrip...    24   7.6  
AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubu...    24   7.6  

>DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative
           methoprene-tolerant protein protein.
          Length = 1115

 Score = 26.6 bits (56), Expect = 1.1
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +2

Query: 689 PPPPPPPP 712
           PPPPPPPP
Sbjct: 783 PPPPPPPP 790



 Score = 26.6 bits (56), Expect = 1.1
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +2

Query: 689 PPPPPPPP 712
           PPPPPPPP
Sbjct: 784 PPPPPPPP 791


>AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative
           differentiation regulator protein.
          Length = 1283

 Score = 24.2 bits (50), Expect = 5.8
 Identities = 17/66 (25%), Positives = 18/66 (27%)
 Frame = -1

Query: 711 GGGGGGGGXXXSXXXXXGXXXXXXXXXXXXXXXXXXXXEXXXXXXXXGXGXXFFXXPRXG 532
           GGGGGGGG   +                                   G G      P  G
Sbjct: 168 GGGGGGGGGGGAGSFAAALRNLAKQADVKEDEPGAGGGGSGGGAPGGGGGSSGGPGPGGG 227

Query: 531 GGGGXR 514
           GGGG R
Sbjct: 228 GGGGGR 233


>DQ655702-1|ABG45862.1|  889|Anopheles gambiae Jxc1 protein.
          Length = 889

 Score = 23.8 bits (49), Expect = 7.6
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +2

Query: 689 PPPPPPP 709
           PPPPPPP
Sbjct: 530 PPPPPPP 536



 Score = 23.8 bits (49), Expect = 7.6
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +2

Query: 692 PPPPPPP 712
           PPPPPPP
Sbjct: 530 PPPPPPP 536


>CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative
           cytoskeletal structural protein protein.
          Length = 1645

 Score = 23.8 bits (49), Expect = 7.6
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = -1

Query: 711 GGGGGGGGXXXS 676
           GGGGGGGG   S
Sbjct: 302 GGGGGGGGKLSS 313


>AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific
           transcription factor FRU-MA protein.
          Length = 960

 Score = 23.8 bits (49), Expect = 7.6
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = -1

Query: 711 GGGGGGGGXXXS 676
           GGGGGGGG   S
Sbjct: 300 GGGGGGGGGGGS 311


>AY785360-1|AAV52864.1|  759|Anopheles gambiae male-specific
           transcription factor FRU-MB protein.
          Length = 759

 Score = 23.8 bits (49), Expect = 7.6
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = -1

Query: 711 GGGGGGGGXXXS 676
           GGGGGGGG   S
Sbjct: 300 GGGGGGGGGGGS 311



 Score = 23.8 bits (49), Expect = 7.6
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = -1

Query: 711 GGGGGGGGXXXS 676
           GGGGGGGG   S
Sbjct: 654 GGGGGGGGGGGS 665



 Score = 23.8 bits (49), Expect = 7.6
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = -1

Query: 711 GGGGGGGGXXXS 676
           GGGGGGGG   S
Sbjct: 657 GGGGGGGGSVGS 668


>AY725820-1|AAU50568.1|  593|Anopheles gambiae fruitless
           female-specific zinc-fingerC isoform protein.
          Length = 593

 Score = 23.8 bits (49), Expect = 7.6
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = -1

Query: 711 GGGGGGGGXXXS 676
           GGGGGGGG   S
Sbjct: 252 GGGGGGGGGGGS 263


>AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein.
          Length = 1132

 Score = 23.8 bits (49), Expect = 7.6
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = -1

Query: 711 GGGGGGGGXXXS 676
           GGGGGGGG   S
Sbjct: 553 GGGGGGGGVIGS 564


>AJ439060-12|CAD27763.1|  450|Anopheles gambiae putative tachykinin
           receptor protein.
          Length = 450

 Score = 23.8 bits (49), Expect = 7.6
 Identities = 11/31 (35%), Positives = 16/31 (51%)
 Frame = +3

Query: 24  YLIXGNSL*EFFDYSFMGSQFNRTYFWFFRC 116
           +L   NS+     Y +M  +F R +  FFRC
Sbjct: 341 WLAMSNSMYNPIIYCWMNLRFRRGFQQFFRC 371


>AJ438610-4|CAD27476.1|  593|Anopheles gambiae putative
           transcription factor protein.
          Length = 593

 Score = 23.8 bits (49), Expect = 7.6
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = -1

Query: 711 GGGGGGGGXXXS 676
           GGGGGGGG   S
Sbjct: 16  GGGGGGGGGGPS 27


>AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubule
           binding protein protein.
          Length = 838

 Score = 23.8 bits (49), Expect = 7.6
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = -1

Query: 711 GGGGGGGGXXXS 676
           GGGGGGGG   S
Sbjct: 531 GGGGGGGGREGS 542


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 529,661
Number of Sequences: 2352
Number of extensions: 7341
Number of successful extensions: 301
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 27
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 204
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 102535848
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -