BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_C18 (875 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 75 1e-13 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 74 1e-13 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.057 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_32406| Best HMM Match : VWA (HMM E-Value=8.8e-32) 29 4.9 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 29 4.9 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 74.5 bits (175), Expect = 1e-13 Identities = 35/85 (41%), Positives = 44/85 (51%) Frame = +3 Query: 549 QNRGXXXXKTFXQXAXKXPKXLKXPXWWXFPXGPPPLTXFXKIXPQFKGGKPXXXXKNTR 728 +N+G +T Q A K P +K P W F G PLT KI Q +GG+ K+TR Sbjct: 114 KNQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTR 173 Query: 729 VFPLETPPXPXXFQPCRXPENLSPF 803 FPLE P F+PCR P+ PF Sbjct: 174 RFPLEAPSCALLFRPCRLPDTCPPF 198 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 74.1 bits (174), Expect = 1e-13 Identities = 35/84 (41%), Positives = 43/84 (51%) Frame = +3 Query: 552 NRGXXXXKTFXQXAXKXPKXLKXPXWWXFPXGPPPLTXFXKIXPQFKGGKPXXXXKNTRV 731 N+G +T Q A K P +K P W F G PLT KI Q +GG+ K+TR Sbjct: 86 NQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRR 145 Query: 732 FPLETPPXPXXFQPCRXPENLSPF 803 FPLE P F+PCR P+ PF Sbjct: 146 FPLEAPSCALLFRPCRLPDTCPPF 169 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 48.4 bits (110), Expect = 8e-06 Identities = 26/59 (44%), Positives = 27/59 (45%) Frame = -1 Query: 659 QGGGAXGKXPPXXPF*GFWPFXGXLVKSFXXGXPPILGXXVXPPLXXXKXXPPXXRPGA 483 QGGGA GK P PF G WPF G L+ P IL V PPL RP A Sbjct: 22 QGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 80 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 47.6 bits (108), Expect = 1e-05 Identities = 26/63 (41%), Positives = 27/63 (42%) Frame = -1 Query: 656 GGGAXGKXPPXXPF*GFWPFXGXLVKSFXXGXPPILGXXVXPPLXXXKXXPPXXRPGAGX 477 GGGA GK P PF G WPF G L+ P IL V PPL RP A Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAK 60 Query: 476 XXG 468 G Sbjct: 61 QNG 63 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 47.2 bits (107), Expect = 2e-05 Identities = 25/59 (42%), Positives = 27/59 (45%) Frame = -1 Query: 659 QGGGAXGKXPPXXPF*GFWPFXGXLVKSFXXGXPPILGXXVXPPLXXXKXXPPXXRPGA 483 +GGGA GK P PF G WPF G L+ P IL V PPL RP A Sbjct: 405 EGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 463 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 46.8 bits (106), Expect = 2e-05 Identities = 25/59 (42%), Positives = 27/59 (45%) Frame = -1 Query: 659 QGGGAXGKXPPXXPF*GFWPFXGXLVKSFXXGXPPILGXXVXPPLXXXKXXPPXXRPGA 483 +GGGA GK P PF G WPF G L+ P IL V PPL RP A Sbjct: 758 RGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 816 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 46.8 bits (106), Expect = 2e-05 Identities = 25/59 (42%), Positives = 27/59 (45%) Frame = -1 Query: 659 QGGGAXGKXPPXXPF*GFWPFXGXLVKSFXXGXPPILGXXVXPPLXXXKXXPPXXRPGA 483 +GGGA GK P PF G WPF G L+ P IL V PPL RP A Sbjct: 554 KGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 612 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.4 bits (105), Expect = 3e-05 Identities = 25/58 (43%), Positives = 26/58 (44%) Frame = -1 Query: 656 GGGAXGKXPPXXPF*GFWPFXGXLVKSFXXGXPPILGXXVXPPLXXXKXXPPXXRPGA 483 GGGA GK P PF G WPF G L+ P IL V PPL RP A Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 58 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 46.4 bits (105), Expect = 3e-05 Identities = 25/58 (43%), Positives = 26/58 (44%) Frame = -1 Query: 656 GGGAXGKXPPXXPF*GFWPFXGXLVKSFXXGXPPILGXXVXPPLXXXKXXPPXXRPGA 483 GGGA GK P PF G WPF G L+ P IL V PPL RP A Sbjct: 24 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 81 >SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -1 Query: 767 EXGGARGGFQGENPGIFXXLXGFXXFELXXDFXEXXQGGGAXGK 636 E ARG QGE GIF L GF +L F + QGGGA GK Sbjct: 10 EQESARGSRQGETLGIFIVLSGFATTDLSVRFRDACQGGGAYGK 53 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFGWPFAHMFFRALSPD 51 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 58 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 93 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 SGG LW+ + A LR LA PF FF SPD Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 51 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 35.5 bits (78), Expect = 0.057 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = -3 Query: 660 SGGGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 +GG LW+ + A LR LA PF FF SPD Sbjct: 92 AGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPD 127 >SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 33.1 bits (72), Expect = 0.30 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = +3 Query: 654 PLTXFXKIXPQFKGGKPXXXXKNTRVFPLETPPXPXXFQPCRXP 785 PLT K Q GG+ K+TR FPL P F P P Sbjct: 119 PLTSITKSDAQISGGETRQDYKDTRRFPLAAPSCALLFLPFGLP 162 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -3 Query: 654 GGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 G LW+ + A LR LA PF F+ SPD Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFAHMFYPALSPD 35 >SB_32406| Best HMM Match : VWA (HMM E-Value=8.8e-32) Length = 1074 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 724 PGFSPWKPPRAPPXSNPAVXRKTXPPFFP 810 PG+ PW P P P PPF P Sbjct: 476 PGYRPWPRPGRTPGRRPGYRPGYIPPFVP 504 >SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) Length = 77 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -3 Query: 654 GGGLWEXXTXXAXLRXLAXXXPFGXKFFXGXSPD 553 G LW+ + A LR LA PF F SPD Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFDHMFSPALSPD 35 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,423,200 Number of Sequences: 59808 Number of extensions: 133691 Number of successful extensions: 352 Number of sequences better than 10.0: 50 Number of HSP's better than 10.0 without gapping: 277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 344 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2490695009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -