BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_C17 (933 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P56616 Cluster: Ubiquitin-conjugating enzyme E2 C; n=20... 104 4e-21 UniRef50_O00762 Cluster: Ubiquitin-conjugating enzyme E2 C; n=26... 103 9e-21 UniRef50_UPI000155BB09 Cluster: PREDICTED: hypothetical protein;... 89 2e-16 UniRef50_A6NP33 Cluster: Uncharacterized protein UBE2C; n=14; Th... 89 2e-16 UniRef50_Q9C6Q4 Cluster: Ubiquitin carrier protein; n=10; Eukary... 87 6e-16 UniRef50_A6RMU5 Cluster: Ubiquitin carrier protein; n=6; Ascomyc... 87 8e-16 UniRef50_P52492 Cluster: Ubiquitin-conjugating enzyme E2-18 kDa;... 85 2e-15 UniRef50_Q7SGR9 Cluster: Ubiquitin carrier protein; n=11; Pezizo... 76 1e-12 UniRef50_P61088 Cluster: Ubiquitin-conjugating enzyme E2 N; n=12... 71 6e-11 UniRef50_P63146 Cluster: Ubiquitin-conjugating enzyme E2 B; n=55... 69 1e-10 UniRef50_P35128 Cluster: Ubiquitin-conjugating enzyme E2-17 kDa;... 69 1e-10 UniRef50_P25153 Cluster: Ubiquitin-conjugating enzyme E2-17 kDa;... 69 2e-10 UniRef50_Q4RS31 Cluster: Ubiquitin carrier protein; n=1; Tetraod... 68 3e-10 UniRef50_Q8WXB3 Cluster: Ubiquitin carrier protein; n=8; Bilater... 68 3e-10 UniRef50_A2YII6 Cluster: Ubiquitin carrier protein; n=5; Eukaryo... 68 4e-10 UniRef50_Q4YK13 Cluster: Ubiquitin carrier protein; n=2; Alveola... 68 4e-10 UniRef50_Q7QT23 Cluster: Ubiquitin carrier protein; n=1; Giardia... 67 7e-10 UniRef50_A0E1Q4 Cluster: Ubiquitin carrier protein; n=6; Eukaryo... 66 1e-09 UniRef50_A2YZH4 Cluster: Ubiquitin carrier protein; n=3; Spermat... 66 2e-09 UniRef50_A2F2A5 Cluster: Ubiquitin carrier protein; n=1; Trichom... 64 5e-09 UniRef50_Q9I7T6 Cluster: Ubiquitin carrier protein; n=5; Eukaryo... 64 6e-09 UniRef50_A2F262 Cluster: Ubiquitin carrier protein; n=3; Eukaryo... 64 6e-09 UniRef50_P35132 Cluster: SUMO-conjugating enzyme UBC9; n=75; Euk... 63 8e-09 UniRef50_Q98S78 Cluster: Ubiquitin-conjugating enzyme E2-17 KD s... 63 1e-08 UniRef50_Q9C8X7 Cluster: Putative ubiquitin conjugating enzyme; ... 62 3e-08 UniRef50_UPI00005A4DED Cluster: PREDICTED: similar to ubiquitin-... 61 3e-08 UniRef50_Q0R0E7 Cluster: Ubiquitin carrier protein; n=1; Symbiod... 61 3e-08 UniRef50_UPI00015B555D Cluster: PREDICTED: similar to ubiquitin-... 61 5e-08 UniRef50_A2D9T6 Cluster: Ubiquitin carrier protein; n=1; Trichom... 60 6e-08 UniRef50_A6NLF6 Cluster: Ubiquitin carrier protein; n=4; Eutheri... 60 6e-08 UniRef50_P52484 Cluster: Probable ubiquitin-conjugating enzyme E... 60 8e-08 UniRef50_Q7SXH5 Cluster: Ubiquitin carrier protein; n=9; Eukaryo... 60 1e-07 UniRef50_A2EHU5 Cluster: Ubiquitin carrier protein; n=1; Trichom... 59 1e-07 UniRef50_Q54J12 Cluster: Ubiquitin carrier protein; n=1; Dictyos... 59 2e-07 UniRef50_Q8SSK8 Cluster: UBIQUITIN CONJUGATING ENZYME E2; n=1; E... 59 2e-07 UniRef50_Q7QVV7 Cluster: Ubiquitin carrier protein; n=1; Giardia... 58 2e-07 UniRef50_A2FS62 Cluster: Ubiquitin carrier protein; n=1; Trichom... 58 2e-07 UniRef50_A3FPP4 Cluster: Ubiquitin carrier protein; n=1; Cryptos... 58 3e-07 UniRef50_Q8SQR1 Cluster: Ubiquitin carrier protein; n=1; Encepha... 58 3e-07 UniRef50_A2GLA4 Cluster: Ubiquitin-conjugating enzyme family pro... 58 4e-07 UniRef50_A6NGR2 Cluster: Uncharacterized protein UBE2A (Ubiquiti... 58 4e-07 UniRef50_Q75AF2 Cluster: NEDD8-conjugating enzyme UBC12; n=2; Er... 58 4e-07 UniRef50_Q96LR5 Cluster: Ubiquitin-conjugating enzyme E2 E2; n=1... 58 4e-07 UniRef50_UPI0000F2B380 Cluster: PREDICTED: similar to Chain B, C... 57 6e-07 UniRef50_Q8LGF7 Cluster: Ubiquitin carrier protein; n=7; Eukaryo... 57 6e-07 UniRef50_P62837 Cluster: Ubiquitin-conjugating enzyme E2 D2 (EC ... 57 6e-07 UniRef50_Q9NPD8 Cluster: Ubiquitin-conjugating enzyme E2 T; n=16... 57 7e-07 UniRef50_Q6CSW8 Cluster: NEDD8-conjugating enzyme UBC12; n=1; Kl... 57 7e-07 UniRef50_Q57XM0 Cluster: Ubiquitin carrier protein; n=1; Trypano... 56 1e-06 UniRef50_Q4DVH2 Cluster: Ubiquitin carrier protein; n=2; Trypano... 56 1e-06 UniRef50_A0E347 Cluster: Ubiquitin carrier protein; n=4; Eukaryo... 56 1e-06 UniRef50_Q16763 Cluster: Ubiquitin-conjugating enzyme E2 S; n=33... 56 1e-06 UniRef50_Q9FI61 Cluster: Ubiquitin carrier protein; n=3; Viridip... 56 1e-06 UniRef50_Q43780 Cluster: Ubiquitin carrier protein; n=15; Eukary... 56 1e-06 UniRef50_Q5CQL8 Cluster: Ubiquitin carrier protein; n=2; Cryptos... 56 2e-06 UniRef50_Q4PH88 Cluster: Ubiquitin carrier protein; n=3; Dikarya... 56 2e-06 UniRef50_P61086 Cluster: Ubiquitin-conjugating enzyme E2-25 kDa ... 56 2e-06 UniRef50_UPI0000ECA0A1 Cluster: Ubiquitin-conjugating enzyme E2 ... 55 2e-06 UniRef50_Q9VYN3 Cluster: Ubiquitin carrier protein; n=2; Sophoph... 55 2e-06 UniRef50_A6RUK1 Cluster: Ubiquitin carrier protein; n=2; Sclerot... 55 2e-06 UniRef50_A2QG50 Cluster: Ubiquitin carrier protein; n=1; Aspergi... 55 2e-06 UniRef50_Q4QBT6 Cluster: Ubiquitin-conjugating enzyme-like prote... 55 3e-06 UniRef50_A2GNR9 Cluster: Ubiquitin conjugating protein, putative... 55 3e-06 UniRef50_P62256 Cluster: Ubiquitin-conjugating enzyme E2 H; n=51... 55 3e-06 UniRef50_P52491 Cluster: NEDD8-conjugating enzyme UBC12; n=3; Sa... 55 3e-06 UniRef50_Q6C9W0 Cluster: NEDD8-conjugating enzyme UBC12; n=41; E... 55 3e-06 UniRef50_Q8I4X8 Cluster: Ubiquitin carrier protein; n=2; Plasmod... 54 4e-06 UniRef50_Q4QIK2 Cluster: Ubiquitin carrier protein; n=6; Trypano... 54 4e-06 UniRef50_A5DY26 Cluster: Ubiquitin carrier protein; n=3; Sacchar... 54 4e-06 UniRef50_Q5UQC9 Cluster: Probable ubiquitin-conjugating enzyme E... 54 4e-06 UniRef50_Q4SUR6 Cluster: Ubiquitin carrier protein; n=1; Tetraod... 54 5e-06 UniRef50_Q9LQI1 Cluster: F15O4.3; n=1; Arabidopsis thaliana|Rep:... 54 5e-06 UniRef50_Q54TI6 Cluster: Ubiquitin carrier protein; n=1; Dictyos... 54 5e-06 UniRef50_A0CH05 Cluster: Chromosome undetermined scaffold_18, wh... 54 5e-06 UniRef50_O74549 Cluster: NEDD8-conjugating enzyme ubc12; n=10; D... 54 5e-06 UniRef50_P61081 Cluster: NEDD8-conjugating enzyme Ubc12; n=24; E... 54 5e-06 UniRef50_UPI00006CC0C2 Cluster: Ubiquitin-conjugating enzyme fam... 53 9e-06 UniRef50_UPI0000498C2E Cluster: ubiquitin-conjugating enzyme; n=... 53 9e-06 UniRef50_Q0R0E6 Cluster: Ubiquitin carrier protein; n=1; Symbiod... 53 9e-06 UniRef50_Q7QVX4 Cluster: Ubiquitin carrier protein; n=1; Giardia... 53 9e-06 UniRef50_P63279 Cluster: SUMO-conjugating enzyme UBC9; n=74; Euk... 53 9e-06 UniRef50_Q9N2W9 Cluster: Ubiquitin carrier protein; n=1; Caenorh... 53 1e-05 UniRef50_Q6LFK4 Cluster: Ubiquitin-conjugating enzyme E2, putati... 53 1e-05 UniRef50_Q54IK3 Cluster: Ubiquitin carrier protein; n=1; Dictyos... 53 1e-05 UniRef50_Q54F00 Cluster: Ubiquitin carrier protein; n=3; Eukaryo... 53 1e-05 UniRef50_Q4Y3H7 Cluster: Ubiquitin carrier protein; n=1; Plasmod... 53 1e-05 UniRef50_Q6CPL4 Cluster: Kluyveromyces lactis strain NRRL Y-1140... 52 2e-05 UniRef50_Q4WNS9 Cluster: Ubiquitin carrier protein; n=4; Ascomyc... 52 2e-05 UniRef50_A7TRY4 Cluster: Putative uncharacterized protein; n=1; ... 52 2e-05 UniRef50_A7TMT8 Cluster: Putative uncharacterized protein; n=1; ... 52 2e-05 UniRef50_A5E394 Cluster: Putative uncharacterized protein; n=1; ... 52 2e-05 UniRef50_P28263 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa;... 52 2e-05 UniRef50_A2WYK3 Cluster: Ubiquitin carrier protein; n=2; Oryza s... 52 2e-05 UniRef50_A2DXW4 Cluster: Ubiquitin carrier protein; n=2; Trichom... 52 2e-05 UniRef50_A0C0C6 Cluster: Chromosome undetermined scaffold_14, wh... 52 2e-05 UniRef50_Q4PBN3 Cluster: Ubiquitin carrier protein; n=1; Ustilag... 52 2e-05 UniRef50_UPI00015B62F0 Cluster: PREDICTED: hypothetical protein;... 52 3e-05 UniRef50_UPI00006CB812 Cluster: Ubiquitin-conjugating enzyme fam... 52 3e-05 UniRef50_A2FAR7 Cluster: Ubiquitin carrier protein; n=1; Trichom... 52 3e-05 UniRef50_Q22BX5 Cluster: Ubiquitin carrier protein; n=5; Tetrahy... 51 4e-05 UniRef50_A0C3F7 Cluster: Ubiquitin carrier protein; n=2; Paramec... 51 4e-05 UniRef50_Q9LV54 Cluster: Ubiquitin carrier protein; n=2; Arabido... 51 5e-05 UniRef50_Q4Q3Q8 Cluster: Ubiquitin carrier protein; n=4; Leishma... 51 5e-05 UniRef50_Q7KNM2 Cluster: Ubiquitin carrier protein; n=39; Eukary... 50 6e-05 UniRef50_Q54I43 Cluster: Ubiquitin carrier protein; n=3; Eukaryo... 50 6e-05 UniRef50_A7RL90 Cluster: Predicted protein; n=2; Nematostella ve... 50 6e-05 UniRef50_A4RG25 Cluster: Putative uncharacterized protein; n=4; ... 50 6e-05 UniRef50_A2E5I6 Cluster: Ubiquitin carrier protein; n=1; Trichom... 50 8e-05 UniRef50_Q8SRC0 Cluster: Ubiquitin carrier protein; n=1; Encepha... 50 8e-05 UniRef50_Q5KIQ6 Cluster: Ubiquitin carrier protein; n=1; Filobas... 50 8e-05 UniRef50_Q5A7Q5 Cluster: Ubiquitin carrier protein; n=2; Ascomyc... 50 8e-05 UniRef50_Q4PGW5 Cluster: Ubiquitin carrier protein; n=2; Basidio... 50 8e-05 UniRef50_A7RLE1 Cluster: Predicted protein; n=1; Nematostella ve... 50 1e-04 UniRef50_A0CVS4 Cluster: Chromosome undetermined scaffold_295, w... 50 1e-04 UniRef50_Q55U75 Cluster: Ubiquitin carrier protein; n=2; Filobas... 50 1e-04 UniRef50_P21734 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa;... 50 1e-04 UniRef50_UPI000049916F Cluster: ubiquitin-conjugating enzyme; n=... 49 1e-04 UniRef50_Q586X5 Cluster: Ubiquitin carrier protein; n=3; Trypano... 49 1e-04 UniRef50_A3FQP7 Cluster: Ubiquitin carrier protein; n=2; Cryptos... 49 1e-04 UniRef50_A2EP72 Cluster: Ubiquitin carrier protein; n=1; Trichom... 49 1e-04 UniRef50_Q0JLE6 Cluster: Ubiquitin carrier protein; n=4; Magnoli... 49 2e-04 UniRef50_Q4N5Y1 Cluster: Ubiquitin carrier protein; n=3; Piropla... 49 2e-04 UniRef50_A2G420 Cluster: Ubiquitin carrier protein; n=1; Trichom... 49 2e-04 UniRef50_A2EJF5 Cluster: Ubiquitin-conjugating enzyme family pro... 49 2e-04 UniRef50_Q1DRT9 Cluster: Ubiquitin carrier protein; n=1; Coccidi... 49 2e-04 UniRef50_Q8IH42 Cluster: Ubiquitin carrier protein; n=15; Fungi/... 48 3e-04 UniRef50_Q24HQ3 Cluster: Ubiquitin carrier protein; n=1; Tetrahy... 48 3e-04 UniRef50_Q4WU34 Cluster: Ubiquitin carrier protein; n=16; Pezizo... 48 3e-04 UniRef50_A5DB66 Cluster: Ubiquitin carrier protein; n=1; Pichia ... 48 3e-04 UniRef50_P62253 Cluster: Ubiquitin-conjugating enzyme E2 G1; n=6... 48 3e-04 UniRef50_Q9AW53 Cluster: Ubiquitin carrier protein; n=1; Guillar... 48 3e-04 UniRef50_Q7R2Z1 Cluster: Ubiquitin carrier protein; n=1; Giardia... 48 3e-04 UniRef50_Q5DI37 Cluster: Ubiquitin carrier protein; n=2; Schisto... 48 3e-04 UniRef50_Q9LJD7 Cluster: Constitutive photomorphogenesis protein... 48 3e-04 UniRef50_UPI0000E4A01C Cluster: PREDICTED: similar to ENSANGP000... 48 5e-04 UniRef50_Q247Y5 Cluster: Ubiquitin carrier protein; n=1; Tetrahy... 48 5e-04 UniRef50_Q6MYZ2 Cluster: Ubiquitin carrier protein; n=7; Trichoc... 48 5e-04 UniRef50_Q0TZE7 Cluster: Ubiquitin carrier protein; n=1; Phaeosp... 48 5e-04 UniRef50_Q8IJ70 Cluster: Ubiquitin carrier protein; n=9; Aconoid... 47 6e-04 UniRef50_A0BKX8 Cluster: Chromosome undetermined scaffold_113, w... 47 6e-04 UniRef50_Q4P877 Cluster: Ubiquitin carrier protein; n=1; Ustilag... 47 6e-04 UniRef50_Q8LC61 Cluster: E2, ubiquitin-conjugating enzyme, putat... 47 8e-04 UniRef50_Q7QWW0 Cluster: Ubiquitin carrier protein; n=1; Giardia... 47 8e-04 UniRef50_A2EY78 Cluster: Ubiquitin carrier protein; n=1; Trichom... 47 8e-04 UniRef50_A2EGV7 Cluster: Ubiquitin carrier protein; n=1; Trichom... 47 8e-04 UniRef50_Q9UTN8 Cluster: Ubiquitin conjugating enzyme Ubc14; n=1... 47 8e-04 UniRef50_Q95017 Cluster: SUMO-conjugating enzyme UBC9; n=7; Euka... 47 8e-04 UniRef50_UPI00006CC8BE Cluster: Ubiquitin-conjugating enzyme fam... 46 0.001 UniRef50_Q9VUR4 Cluster: Ubiquitin carrier protein; n=7; Eukaryo... 46 0.001 UniRef50_Q753J8 Cluster: AFR314Wp; n=1; Eremothecium gossypii|Re... 46 0.001 UniRef50_Q5BE71 Cluster: Ubiquitin carrier protein; n=2; Trichoc... 46 0.001 UniRef50_A7TP75 Cluster: Putative uncharacterized protein; n=1; ... 46 0.001 UniRef50_Q54P16 Cluster: Ubiquitin conjugating enzyme; n=2; Dict... 46 0.001 UniRef50_Q4UI29 Cluster: Ubiquitin-conjugating enzyme E2 (RUB1 h... 46 0.001 UniRef50_A7RTQ5 Cluster: Predicted protein; n=1; Nematostella ve... 46 0.001 UniRef50_A7ARW5 Cluster: Putative uncharacterized protein; n=1; ... 46 0.001 UniRef50_A2DRC1 Cluster: Ubiquitin carrier protein; n=1; Trichom... 46 0.001 UniRef50_A0EBF3 Cluster: Ubiquitin carrier protein; n=1; Paramec... 46 0.001 UniRef50_Q1E8C5 Cluster: Ubiquitin carrier protein; n=9; Pezizom... 46 0.001 UniRef50_Q9P6I1 Cluster: Ubiquitin-conjugating enzyme E2 16; n=1... 46 0.001 UniRef50_Q8ILW5 Cluster: Ubiquitin conjugating enzyme, putative;... 46 0.002 UniRef50_Q4CQP3 Cluster: Ubiquitin carrier protein; n=4; Trypano... 46 0.002 UniRef50_P60604 Cluster: Ubiquitin-conjugating enzyme E2 G2; n=8... 46 0.002 UniRef50_UPI0000E487EE Cluster: PREDICTED: similar to ubiquitin ... 45 0.002 UniRef50_Q9FF66 Cluster: Ubiquitin carrier protein; n=8; Viridip... 45 0.002 UniRef50_Q4Q5L3 Cluster: Ubiquitin carrier protein; n=6; Trypano... 45 0.002 UniRef50_A0BIB5 Cluster: Chromosome undetermined scaffold_11, wh... 45 0.002 UniRef50_Q6E683 Cluster: Ubiquitin carrier protein; n=1; Antonos... 45 0.002 UniRef50_A6RGW5 Cluster: Ubiquitin carrier protein; n=1; Ajellom... 45 0.002 UniRef50_UPI00001628C0 Cluster: UBC7 (ubiquitin-conjugating enzy... 45 0.003 UniRef50_A6SKB5 Cluster: Putative uncharacterized protein; n=2; ... 45 0.003 UniRef50_A3C6U5 Cluster: Ubiquitin carrier protein; n=2; Oryza s... 44 0.004 UniRef50_A2E403 Cluster: Ubiquitin carrier protein; n=1; Trichom... 44 0.004 UniRef50_UPI0000D56950 Cluster: PREDICTED: similar to Ubiquitin-... 44 0.006 UniRef50_UPI0000499A56 Cluster: ubiquitin-conjugating enzyme; n=... 44 0.006 UniRef50_Q8SR07 Cluster: UBIQUITIN CONJUGATING ENZYME E2-20K; n=... 44 0.006 UniRef50_Q5YES5 Cluster: Ubiquitin conjugating enzyme E2 2; n=1;... 44 0.007 UniRef50_Q0JAS6 Cluster: Os04g0580400 protein; n=1; Oryza sativa... 44 0.007 UniRef50_A2F4E2 Cluster: Ubiquitin carrier protein; n=1; Trichom... 44 0.007 UniRef50_A0C227 Cluster: Chromosome undetermined scaffold_143, w... 44 0.007 UniRef50_Q8SSK3 Cluster: UBIQUITIN CONJUGATING ENZYME E2; n=1; E... 44 0.007 UniRef50_Q6BZP7 Cluster: Similarity; n=1; Yarrowia lipolytica|Re... 44 0.007 UniRef50_Q5A339 Cluster: Ubiquitin carrier protein; n=2; Eukaryo... 44 0.007 UniRef50_Q5VVX9 Cluster: Ubiquitin-conjugating enzyme E2 U; n=11... 44 0.007 UniRef50_UPI0000F2B508 Cluster: PREDICTED: similar to ubiquitin-... 43 0.010 UniRef50_Q0JI74 Cluster: Ubiquitin carrier protein; n=2; Oryza s... 43 0.010 UniRef50_A3AAT7 Cluster: Putative uncharacterized protein; n=4; ... 43 0.010 UniRef50_Q0IF72 Cluster: Ubiquitin-conjugating enzyme morgue; n=... 43 0.010 UniRef50_Q6E689 Cluster: Ubiquitin carrier protein; n=1; Antonos... 43 0.010 UniRef50_UPI0000F2BBBB Cluster: PREDICTED: similar to ubiquitin-... 43 0.013 UniRef50_Q0TYP6 Cluster: Putative uncharacterized protein; n=1; ... 43 0.013 UniRef50_A6R4R4 Cluster: Putative uncharacterized protein; n=2; ... 43 0.013 UniRef50_P49428 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa;... 43 0.013 UniRef50_Q712K3 Cluster: Ubiquitin-conjugating enzyme E2 R2; n=6... 43 0.013 UniRef50_Q6C713 Cluster: Similarities with DEHA0D15444g Debaryom... 42 0.017 UniRef50_A6RY09 Cluster: Putative uncharacterized protein; n=1; ... 42 0.017 UniRef50_P29340 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa;... 42 0.017 UniRef50_Q7QQ94 Cluster: Ubiquitin carrier protein; n=1; Giardia... 42 0.022 UniRef50_Q1EB54 Cluster: Ubiquitin-conjugating enzyme; n=7; Pezi... 42 0.022 UniRef50_P42743 Cluster: Ubiquitin-conjugating enzyme E2-18 kDa;... 42 0.022 UniRef50_A3LYJ5 Cluster: Predicted protein; n=3; Saccharomycetal... 42 0.030 UniRef50_UPI00015B43E7 Cluster: PREDICTED: similar to ubiquitin-... 41 0.039 UniRef50_Q9VGD6 Cluster: CG14739-PA; n=2; Sophophora|Rep: CG1473... 41 0.052 UniRef50_UPI0000DBF7F5 Cluster: similar to ubiquitin-conjugating... 40 0.068 UniRef50_A2AX46 Cluster: Ubiquitin carrier protein; n=2; Eukaryo... 40 0.068 UniRef50_Q9Y165 Cluster: CG15437-PA; n=4; Sophophora|Rep: CG1543... 40 0.068 UniRef50_A0D4V6 Cluster: Chromosome undetermined scaffold_38, wh... 40 0.068 UniRef50_Q5BAL7 Cluster: Putative uncharacterized protein; n=3; ... 40 0.068 UniRef50_UPI0000498417 Cluster: ubiquitin-conjugating enzyme; n=... 40 0.090 UniRef50_Q0UIW0 Cluster: Putative uncharacterized protein; n=1; ... 40 0.090 UniRef50_A1DHS5 Cluster: Ubiquitin conjugating enzyme, putative;... 40 0.090 UniRef50_Q4U8F2 Cluster: Ubiquitin carrier protein; n=2; Piropla... 40 0.12 UniRef50_A0CD76 Cluster: Ubiquitin carrier protein; n=4; Paramec... 40 0.12 UniRef50_A7TL65 Cluster: Putative uncharacterized protein; n=1; ... 40 0.12 UniRef50_P27949 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa;... 40 0.12 UniRef50_P14682 Cluster: Ubiquitin-conjugating enzyme E2-34 kDa;... 40 0.12 UniRef50_UPI0000D57489 Cluster: PREDICTED: similar to CG15437-PA... 39 0.16 UniRef50_UPI0000519DF4 Cluster: PREDICTED: similar to modifier o... 39 0.16 UniRef50_Q5DD88 Cluster: Ubiquitin carrier protein; n=2; Schisto... 39 0.16 UniRef50_Q9BQP0 Cluster: Ubiquitin-conjugating enzyme E2C; n=4; ... 39 0.16 UniRef50_A2ADC1 Cluster: Novel protein containing an Ubiquitin-c... 39 0.21 UniRef50_Q20617 Cluster: Putative uncharacterized protein ubc-24... 39 0.21 UniRef50_A2DSA6 Cluster: Ubiquitin carrier protein; n=1; Trichom... 39 0.21 UniRef50_Q4P8X0 Cluster: Putative uncharacterized protein; n=1; ... 39 0.21 UniRef50_A7EC39 Cluster: Putative uncharacterized protein; n=1; ... 39 0.21 UniRef50_UPI00006064E0 Cluster: PREDICTED: similar to ubiquitin-... 38 0.28 UniRef50_Q28XJ5 Cluster: GA20189-PA; n=1; Drosophila pseudoobscu... 38 0.28 UniRef50_A7STQ7 Cluster: Predicted protein; n=2; Nematostella ve... 38 0.28 UniRef50_Q8SS54 Cluster: Ubiquitin carrier protein; n=1; Encepha... 38 0.28 UniRef50_Q2H4J3 Cluster: Putative uncharacterized protein; n=2; ... 38 0.36 UniRef50_A5DNI5 Cluster: Putative uncharacterized protein; n=1; ... 38 0.36 UniRef50_O14933 Cluster: Ubiquitin/ISG15-conjugating enzyme E2 L... 38 0.36 UniRef50_A2EFK5 Cluster: Ubiquitin carrier protein; n=1; Trichom... 38 0.48 UniRef50_Q96B02 Cluster: Probable ubiquitin-conjugating enzyme E... 38 0.48 UniRef50_Q54J27 Cluster: Ubiquitin carrier protein; n=6; Eukaryo... 37 0.64 UniRef50_Q20872 Cluster: Ubiquitin e2 (Conjugating enzyme) varia... 37 0.64 UniRef50_A0C867 Cluster: Ubiquitin carrier protein; n=4; Oligohy... 37 0.64 UniRef50_P68036 Cluster: Ubiquitin-conjugating enzyme E2 L3; n=6... 37 0.84 UniRef50_Q4N4K0 Cluster: Ubiquitin-protein ligase, putative; n=3... 36 1.1 UniRef50_A2EHL8 Cluster: Ubiquitin-conjugating enzyme family pro... 36 1.1 UniRef50_Q9QZU9 Cluster: Ubiquitin/ISG15-conjugating enzyme E2 L... 36 1.1 UniRef50_UPI000066142F Cluster: Homolog of Brachydanio rerio "Ub... 36 1.5 UniRef50_Q96JB9 Cluster: Ubiquitin UBF-fl; n=1; Homo sapiens|Rep... 36 1.5 UniRef50_Q4Q5I6 Cluster: Ubiquitin carrier protein; n=5; Trypano... 36 1.9 UniRef50_A0DRM5 Cluster: Chromosome undetermined scaffold_60, wh... 35 2.6 UniRef50_Q2U429 Cluster: Ubiquitin carrier protein; n=7; Pezizom... 35 2.6 UniRef50_Q4T6K8 Cluster: Chromosome undetermined SCAF8718, whole... 35 3.4 UniRef50_Q38FP6 Cluster: Putative uncharacterized protein; n=1; ... 35 3.4 UniRef50_A2QMZ8 Cluster: Ubiquitin carrier protein; n=7; Pezizom... 35 3.4 UniRef50_UPI000150A88B Cluster: Ubiquitin-conjugating enzyme fam... 34 4.5 UniRef50_A3AAU2 Cluster: Putative uncharacterized protein; n=3; ... 34 4.5 UniRef50_Q7QWL1 Cluster: GLP_762_41239_41676; n=1; Giardia lambl... 34 4.5 UniRef50_Q2KGQ4 Cluster: Ubiquitin carrier protein; n=1; Magnapo... 34 4.5 UniRef50_UPI000050708E Cluster: PREDICTED: similar to ubiquitin-... 34 5.9 UniRef50_Q8IDP1 Cluster: Ubiquitin-conjugating enzyme, putative;... 34 5.9 UniRef50_Q00WD5 Cluster: Chromosome 14 contig 1, DNA sequence; n... 33 7.9 UniRef50_Q7RKD2 Cluster: Putative uncharacterized protein PY0296... 33 7.9 UniRef50_A0CCE4 Cluster: Chromosome undetermined scaffold_167, w... 33 7.9 >UniRef50_P56616 Cluster: Ubiquitin-conjugating enzyme E2 C; n=20; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 C - Xenopus laevis (African clawed frog) Length = 179 Score = 104 bits (249), Expect = 4e-21 Identities = 51/95 (53%), Positives = 61/95 (64%) Frame = +3 Query: 345 SENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLIC 524 S+NLFKWIGTI+G + P + + P FHPNVD+ G IC Sbjct: 56 SDNLFKWIGTIDGAVGTVYEDLRYKLSLEFPSGYPYNAPTVKFV-TPCFHPNVDSHGNIC 114 Query: 525 LDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 LDILKDKW+ALYDVRT+LLS+QSLL EPN +SPLN Sbjct: 115 LDILKDKWSALYDVRTILLSLQSLLGEPNNESPLN 149 Score = 48.8 bits (111), Expect = 2e-04 Identities = 34/103 (33%), Positives = 51/103 (49%) Frame = +2 Query: 182 AQNINPHYASSSNPAKQSEDTIKLKDNHAVSKRLQKELMELMRCSDKGISAFPXKRKPLQ 361 +QN++P A+SS +++ +++ +V KRLQ+ELM LM DKGISAFP + Sbjct: 3 SQNVDPA-AASSVASRKGQESGTSAARGSVGKRLQQELMTLMMSGDKGISAFPESDNLFK 61 Query: 362 MDRDHQWTFXKLYTQATNTNYHLNFQIHTHTHHLFVKFMTPCF 490 +Y + L F + VKF+TPCF Sbjct: 62 WIGTIDGAVGTVY-EDLRYKLSLEFPSGYPYNAPTVKFVTPCF 103 >UniRef50_O00762 Cluster: Ubiquitin-conjugating enzyme E2 C; n=26; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 C - Homo sapiens (Human) Length = 179 Score = 103 bits (246), Expect = 9e-21 Identities = 51/96 (53%), Positives = 60/96 (62%) Frame = +3 Query: 345 SENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLIC 524 S+NLFKW+GTI+G P + L P +HPNVDT G IC Sbjct: 56 SDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFL-TPCYHPNVDTQGNIC 114 Query: 525 LDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNS 632 LDILK+KW+ALYDVRT+LLSIQSLL EPN SPLN+ Sbjct: 115 LDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNT 150 Score = 41.1 bits (92), Expect = 0.039 Identities = 33/103 (32%), Positives = 46/103 (44%) Frame = +2 Query: 182 AQNINPHYASSSNPAKQSEDTIKLKDNHAVSKRLQKELMELMRCSDKGISAFPXKRKPLQ 361 +QN +P A+S A++ + V KRLQ+ELM LM DKGISAFP + Sbjct: 3 SQNRDPA-ATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFK 61 Query: 362 MDRDHQWTFXKLYTQATNTNYHLNFQIHTHTHHLFVKFMTPCF 490 +Y + L F + VKF+TPC+ Sbjct: 62 WVGTIHGAAGTVY-EDLRYKLSLEFPSGYPYNAPTVKFLTPCY 103 >UniRef50_UPI000155BB09 Cluster: PREDICTED: hypothetical protein; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: hypothetical protein - Ornithorhynchus anatinus Length = 789 Score = 88.6 bits (210), Expect = 2e-16 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNS 632 P +HPNVD G ICLDILKDKW+ALYDVRT+LLSIQSLL EPN SPLN+ Sbjct: 707 PCYHPNVDAQGNICLDILKDKWSALYDVRTILLSIQSLLGEPNVDSPLNT 756 >UniRef50_A6NP33 Cluster: Uncharacterized protein UBE2C; n=14; Theria|Rep: Uncharacterized protein UBE2C - Homo sapiens (Human) Length = 150 Score = 88.6 bits (210), Expect = 2e-16 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNS 632 P +HPNVDT G ICLDILK+KW+ALYDVRT+LLSIQSLL EPN SPLN+ Sbjct: 72 PCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNT 121 Score = 34.7 bits (76), Expect = 3.4 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = +1 Query: 397 VYAGHKYKLSLEFPNSYPYAPP 462 VY +YKLSLEFP+ YPY P Sbjct: 44 VYEDLRYKLSLEFPSGYPYNAP 65 >UniRef50_Q9C6Q4 Cluster: Ubiquitin carrier protein; n=10; Eukaryota|Rep: Ubiquitin carrier protein - Arabidopsis thaliana (Mouse-ear cress) Length = 195 Score = 87.0 bits (206), Expect = 6e-16 Identities = 45/97 (46%), Positives = 55/97 (56%) Frame = +3 Query: 348 ENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICL 527 +N+F W GTI G S P + + FHPNVD G ICL Sbjct: 77 DNIFCWKGTITGSKDTVFEGTEYRLSLSFSNDYPFKPPKVK-FETCCFHPNVDVYGNICL 135 Query: 528 DILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 DIL+DKW++ YDVRT+LLSIQSLL EPN SPLN+ + Sbjct: 136 DILQDKWSSAYDVRTILLSIQSLLGEPNISSPLNTQA 172 >UniRef50_A6RMU5 Cluster: Ubiquitin carrier protein; n=6; Ascomycota|Rep: Ubiquitin carrier protein - Botryotinia fuckeliana B05.10 Length = 223 Score = 86.6 bits (205), Expect = 8e-16 Identities = 44/96 (45%), Positives = 53/96 (55%) Frame = +3 Query: 351 NLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICLD 530 NL W TI+GP P + P++HPNVD G ICLD Sbjct: 104 NLLSWTATIDGPDDTPYASKQFKLSFAFPSNYPYAPPTVL-FKTPIYHPNVDFSGRICLD 162 Query: 531 ILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 ILKDKWTA Y+++TVLLS+QSLL EPN SPLN + Sbjct: 163 ILKDKWTAAYNIQTVLLSLQSLLGEPNNASPLNGEA 198 Score = 37.5 bits (83), Expect = 0.48 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = +1 Query: 394 TVYAGHKYKLSLEFPNSYPYAPP 462 T YA ++KLS FP++YPYAPP Sbjct: 118 TPYASKQFKLSFAFPSNYPYAPP 140 Score = 35.9 bits (79), Expect = 1.5 Identities = 22/52 (42%), Positives = 29/52 (55%) Frame = +2 Query: 185 QNINPHYASSSNPAKQSEDTIKLKDNHAVSKRLQKELMELMRCSDKGISAFP 340 QN +P + AK + K D + +KRLQ ELM+LM + GISAFP Sbjct: 50 QNTSPGDVPPAQAAKLAPR--KGPDAQSTTKRLQTELMQLMTSAAPGISAFP 99 >UniRef50_P52492 Cluster: Ubiquitin-conjugating enzyme E2-18 kDa; n=6; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-18 kDa - Saccharomyces cerevisiae (Baker's yeast) Length = 156 Score = 85.0 bits (201), Expect = 2e-15 Identities = 42/94 (44%), Positives = 56/94 (59%) Frame = +3 Query: 351 NLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICLD 530 +L W+G I GP + P + L P++HPNVD G ICLD Sbjct: 37 DLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKFL-SPMWHPNVDKSGNICLD 95 Query: 531 ILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNS 632 ILK+KW+A+Y+V T+LLS+QSLL EPN +SPLN+ Sbjct: 96 ILKEKWSAVYNVETILLSLQSLLGEPNNRSPLNA 129 >UniRef50_Q7SGR9 Cluster: Ubiquitin carrier protein; n=11; Pezizomycotina|Rep: Ubiquitin carrier protein - Neurospora crassa Length = 212 Score = 75.8 bits (178), Expect = 1e-12 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPN 611 P++HPNVD G ICLDILKDKWTA Y+ +TVLLS+QSLL EPN Sbjct: 169 PIYHPNVDFSGRICLDILKDKWTAAYNTQTVLLSLQSLLGEPN 211 Score = 39.5 bits (88), Expect = 0.12 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = +1 Query: 394 TVYAGHKYKLSLEFPNSYPYAPP 462 T YAG +KLS EFP +YPYAPP Sbjct: 140 TPYAGLTFKLSFEFPANYPYAPP 162 >UniRef50_P61088 Cluster: Ubiquitin-conjugating enzyme E2 N; n=123; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 N - Homo sapiens (Human) Length = 152 Score = 70.5 bits (165), Expect = 6e-11 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 ++HPNVD G ICLDILKDKW+ +RTVLLSIQ+LL+ PN PL Sbjct: 75 IYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL 121 >UniRef50_P63146 Cluster: Ubiquitin-conjugating enzyme E2 B; n=55; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 B - Homo sapiens (Human) Length = 152 Score = 69.3 bits (162), Expect = 1e-10 Identities = 38/96 (39%), Positives = 51/96 (53%) Frame = +3 Query: 351 NLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICLD 530 N+ +W I GP S+ P + + L +FHPNV G ICLD Sbjct: 32 NIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFL-SKMFHPNVYADGSICLD 90 Query: 531 ILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 IL+++W+ YDV ++L SIQSLL EPN SP NS + Sbjct: 91 ILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQA 126 >UniRef50_P35128 Cluster: Ubiquitin-conjugating enzyme E2-17 kDa; n=30; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-17 kDa - Drosophila melanogaster (Fruit fly) Length = 151 Score = 69.3 bits (162), Expect = 1e-10 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 ++HPN+D G ICLD+LKDKW+ +RT+LLSIQ+LL+ PN PL Sbjct: 75 IYHPNIDRLGRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDDPL 121 >UniRef50_P25153 Cluster: Ubiquitin-conjugating enzyme E2-17 kDa; n=93; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-17 kDa - Drosophila melanogaster (Fruit fly) Length = 151 Score = 68.5 bits (160), Expect = 2e-10 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 VFHPNV G ICLDIL+++W+ YDV +L SIQSLL++PN SP NS++ Sbjct: 76 VFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTA 126 >UniRef50_Q4RS31 Cluster: Ubiquitin carrier protein; n=1; Tetraodon nigroviridis|Rep: Ubiquitin carrier protein - Tetraodon nigroviridis (Green puffer) Length = 221 Score = 68.1 bits (159), Expect = 3e-10 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 +FHPNV G ICLDIL+++W+ YDV ++L SIQSLL EPN SP NS + Sbjct: 145 MFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQA 195 >UniRef50_Q8WXB3 Cluster: Ubiquitin carrier protein; n=8; Bilateria|Rep: Ubiquitin carrier protein - Homo sapiens (Human) Length = 80 Score = 68.1 bits (159), Expect = 3e-10 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 +FHPNV G ICLDIL+++W+ YDV ++L SIQSLL EPN SP NS + Sbjct: 17 MFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQA 67 >UniRef50_A2YII6 Cluster: Ubiquitin carrier protein; n=5; Eukaryota|Rep: Ubiquitin carrier protein - Oryza sativa subsp. indica (Rice) Length = 176 Score = 67.7 bits (158), Expect = 4e-10 Identities = 28/51 (54%), Positives = 38/51 (74%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 +FHPN+ G ICLDIL+++W+ +YDV +L SIQSLL +PN SP NS + Sbjct: 100 MFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEA 150 >UniRef50_Q4YK13 Cluster: Ubiquitin carrier protein; n=2; Alveolata|Rep: Ubiquitin carrier protein - Plasmodium berghei Length = 149 Score = 67.7 bits (158), Expect = 4e-10 Identities = 28/48 (58%), Positives = 39/48 (81%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 +FHPN+ T G ICLDIL+++W+ +YD+ ++L SIQSLL +PNT SP N Sbjct: 65 MFHPNIYTDGNICLDILQNQWSPIYDITSLLTSIQSLLNDPNTASPAN 112 >UniRef50_Q7QT23 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 196 Score = 66.9 bits (156), Expect = 7e-10 Identities = 35/97 (36%), Positives = 48/97 (49%) Frame = +3 Query: 348 ENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICL 527 ++LF+W I GP + P + + L +FHPN+ G ICL Sbjct: 36 DDLFRWAAIIIGPSQTPWEGAVIRLELKFTSEYPTKPPAVKVL-TKMFHPNIFNNGNICL 94 Query: 528 DILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 D+L KWT V +LLSIQSLL +PN SP N+ + Sbjct: 95 DLLSTKWTPALGVSAILLSIQSLLTDPNPMSPANNEA 131 >UniRef50_A0E1Q4 Cluster: Ubiquitin carrier protein; n=6; Eukaryota|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 720 Score = 66.1 bits (154), Expect = 1e-09 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 P++HPNV G ICLDILK++WT + DV +L SI+SLL +PN SP N Sbjct: 639 PIYHPNVYPDGRICLDILKEQWTPILDVWAILTSIRSLLCDPNPNSPAN 687 >UniRef50_A2YZH4 Cluster: Ubiquitin carrier protein; n=3; Spermatophyta|Rep: Ubiquitin carrier protein - Oryza sativa subsp. indica (Rice) Length = 284 Score = 65.7 bits (153), Expect = 2e-09 Identities = 35/93 (37%), Positives = 48/93 (51%) Frame = +3 Query: 348 ENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICL 527 E+LF W TI GP + P + + N V+HPN+++ G ICL Sbjct: 28 EDLFHWQATIMGPSDSPYAGGVFFVNIHFPPDYPFKPPKV-NFQTKVYHPNINSNGSICL 86 Query: 528 DILKDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 DILK++W+ + VLLSI SLL +PN PL Sbjct: 87 DILKEQWSPALTISKVLLSISSLLTDPNPDDPL 119 >UniRef50_A2F2A5 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 162 Score = 64.1 bits (149), Expect = 5e-09 Identities = 27/52 (51%), Positives = 36/52 (69%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 PV+HPNV G ICLD+L++KWT YD+ +L SI+SL +PN SP N + Sbjct: 78 PVYHPNVYRDGKICLDMLQNKWTPAYDISAILNSIRSLFDDPNPASPANGEA 129 >UniRef50_Q9I7T6 Cluster: Ubiquitin carrier protein; n=5; Eukaryota|Rep: Ubiquitin carrier protein - Drosophila melanogaster (Fruit fly) Length = 354 Score = 63.7 bits (148), Expect = 6e-09 Identities = 35/99 (35%), Positives = 46/99 (46%) Frame = +3 Query: 339 LXSENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGL 518 + +NLF W+ TI GP + P L+ L +H N+ G Sbjct: 232 MVGDNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPFYPPYLAFL-TKTYHCNIALSGR 290 Query: 519 ICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSS 635 ICLDIL KW+ V VL+SI SLLA+PN P+ S Sbjct: 291 ICLDILGSKWSPALSVSKVLISIMSLLADPNPHDPMEVS 329 >UniRef50_A2F262 Cluster: Ubiquitin carrier protein; n=3; Eukaryota|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 150 Score = 63.7 bits (148), Expect = 6e-09 Identities = 25/49 (51%), Positives = 36/49 (73%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNS 632 ++HPN+D G ICLDILK +WT + ++ T +LSIQSL+ EP + PL + Sbjct: 74 IYHPNIDKLGRICLDILKTEWTPVMNIETTVLSIQSLMCEPCLEDPLET 122 >UniRef50_P35132 Cluster: SUMO-conjugating enzyme UBC9; n=75; Eukaryota|Rep: SUMO-conjugating enzyme UBC9 - Arabidopsis thaliana (Mouse-ear cress) Length = 148 Score = 63.3 bits (147), Expect = 8e-09 Identities = 34/94 (36%), Positives = 49/94 (52%) Frame = +3 Query: 345 SENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLIC 524 +E++F W TI GP + P + ++ VFHPN+++ G IC Sbjct: 27 AEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVA-FRTKVFHPNINSNGSIC 85 Query: 525 LDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 LDILK++W+ + VLLSI SLL +PN PL Sbjct: 86 LDILKEQWSPALTISKVLLSICSLLTDPNPDDPL 119 >UniRef50_Q98S78 Cluster: Ubiquitin-conjugating enzyme E2-17 KD subunit; n=1; Guillardia theta|Rep: Ubiquitin-conjugating enzyme E2-17 KD subunit - Guillardia theta (Cryptomonas phi) Length = 147 Score = 62.9 bits (146), Expect = 1e-08 Identities = 32/94 (34%), Positives = 48/94 (51%) Frame = +3 Query: 348 ENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICL 527 EN+F W TI GP+ + S+ P + + HPN+ + G +C+ Sbjct: 31 ENIFMWCATIIGPVNSPYSGILVKVQINFSENYPYDPPTIYIRNRHIIHPNIYSNGKVCI 90 Query: 528 DILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 DIL KW+ +Y T+LLS++ LL PN+ SP N Sbjct: 91 DILNKKWSPVYSNITLLLSLKILLEFPNSDSPAN 124 >UniRef50_Q9C8X7 Cluster: Putative ubiquitin conjugating enzyme; 36006-34873; n=1; Arabidopsis thaliana|Rep: Putative ubiquitin conjugating enzyme; 36006-34873 - Arabidopsis thaliana (Mouse-ear cress) Length = 154 Score = 61.7 bits (143), Expect = 3e-08 Identities = 33/94 (35%), Positives = 45/94 (47%) Frame = +3 Query: 345 SENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLIC 524 S N+++W I GP P + + P++HPN++ G IC Sbjct: 33 SNNIYEWTAVIRGPDGTPYEGGMFNLSIKFPTDYPFKPPKFT-FKTPIYHPNINDEGSIC 91 Query: 525 LDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 ++ILKDKWT V VLLSI LL +PN PL Sbjct: 92 MNILKDKWTPALMVEKVLLSILLLLEKPNPDDPL 125 >UniRef50_UPI00005A4DED Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme E2N; n=1; Canis lupus familiaris|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme E2N - Canis familiaris Length = 284 Score = 61.3 bits (142), Expect = 3e-08 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 ++HPNVD G +CLDILKDKW+ L +RTVLL IQ+LL+ N PL Sbjct: 163 IYHPNVDKLGRVCLDILKDKWSPL-QIRTVLLWIQALLSALNPDDPL 208 >UniRef50_Q0R0E7 Cluster: Ubiquitin carrier protein; n=1; Symbiodinium sp. C3|Rep: Ubiquitin carrier protein - Symbiodinium sp. C3 Length = 167 Score = 61.3 bits (142), Expect = 3e-08 Identities = 36/101 (35%), Positives = 51/101 (50%), Gaps = 1/101 (0%) Frame = +3 Query: 321 KEYQHSLXSENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPN 500 K Q S ++LF W + GP ++ P + + VFHPN Sbjct: 23 KGIQASPVGDDLFNWSAIVLGPQDTAWEGGVWKLKMSFNEEYPEKPPSV-RFENEVFHPN 81 Query: 501 VDTCGLICLDILKDK-WTALYDVRTVLLSIQSLLAEPNTQS 620 + G ICLD+LK W+ YDV T+LL+IQSLLA+P+T + Sbjct: 82 IFPDGQICLDLLKGSGWSPAYDVCTILLAIQSLLADPDTHA 122 >UniRef50_UPI00015B555D Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme UbcD2; n=3; Coelomata|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme UbcD2 - Nasonia vitripennis Length = 176 Score = 60.9 bits (141), Expect = 5e-08 Identities = 33/96 (34%), Positives = 50/96 (52%) Frame = +3 Query: 348 ENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICL 527 +NL++W+ TI GP + S P + ++ ++H N+++ G+ICL Sbjct: 57 DNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVT-FRTRIYHCNINSQGVICL 115 Query: 528 DILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSS 635 DILKD W+ + VLLSI SLL + N PL S Sbjct: 116 DILKDNWSPALTISKVLLSICSLLTDCNPADPLVGS 151 >UniRef50_A2D9T6 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 150 Score = 60.5 bits (140), Expect = 6e-08 Identities = 30/100 (30%), Positives = 51/100 (51%) Frame = +3 Query: 339 LXSENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGL 518 + ++L +W I+GP P + + + ++HPN+ + G Sbjct: 25 ISQKSLLEWEVEIDGPKETIWENGHFRLTVNFPSEYPFKAPSVKFI-TKIYHPNISSTGG 83 Query: 519 ICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 ICLD+L DKW Y+V ++L+SI+S L +PN + LNS + Sbjct: 84 ICLDLLIDKWLPSYNVASLLVSIRSFLDDPNPEHGLNSEA 123 >UniRef50_A6NLF6 Cluster: Ubiquitin carrier protein; n=4; Eutheria|Rep: Ubiquitin carrier protein - Homo sapiens (Human) Length = 146 Score = 60.5 bits (140), Expect = 6e-08 Identities = 32/93 (34%), Positives = 47/93 (50%) Frame = +3 Query: 348 ENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICL 527 ++LF W TI GP + P + ++ ++HPN+++ G ICL Sbjct: 27 DDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFT-TKIYHPNINSNGSICL 85 Query: 528 DILKDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 DIL+ +W+ V VLLSI SLL +PN PL Sbjct: 86 DILRSQWSPALTVSKVLLSICSLLCDPNPDDPL 118 >UniRef50_P52484 Cluster: Probable ubiquitin-conjugating enzyme E2 21; n=5; Caenorhabditis|Rep: Probable ubiquitin-conjugating enzyme E2 21 - Caenorhabditis elegans Length = 229 Score = 60.1 bits (139), Expect = 8e-08 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = +3 Query: 486 VFHPNVDT-CGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSP 623 ++HPN+ + G ICLDILKDKWTA +RTVLLS+Q++L P P Sbjct: 108 IWHPNISSQTGTICLDILKDKWTASLTLRTVLLSLQAMLCSPEPSDP 154 >UniRef50_Q7SXH5 Cluster: Ubiquitin carrier protein; n=9; Eukaryota|Rep: Ubiquitin carrier protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 147 Score = 59.7 bits (138), Expect = 1e-07 Identities = 33/93 (35%), Positives = 47/93 (50%) Frame = +3 Query: 348 ENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICL 527 E+LF W TI GP + P + ++ ++HPN+++ G ICL Sbjct: 28 EDLFHWQATIMGPGDSPYQGGVFFLTIHFPTDYPFKPPKVAFT-TKIYHPNINSNGSICL 86 Query: 528 DILKDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 DIL+ +W+ V VLLSI SLL +PN PL Sbjct: 87 DILRSQWSPALTVSKVLLSICSLLCDPNPDDPL 119 >UniRef50_A2EHU5 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 173 Score = 59.3 bits (137), Expect = 1e-07 Identities = 26/54 (48%), Positives = 35/54 (64%), Gaps = 4/54 (7%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDILK----DKWTALYDVRTVLLSIQSLLAEPNTQSPLNS 632 P++HPN+D+ G ICLD LK KWTA + +L IQ L+AEPN PL++ Sbjct: 76 PIYHPNIDSSGRICLDFLKPQPQGKWTATVSLEMLLTQIQQLMAEPNPNDPLDT 129 >UniRef50_Q54J12 Cluster: Ubiquitin carrier protein; n=1; Dictyostelium discoideum AX4|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 549 Score = 58.8 bits (136), Expect = 2e-07 Identities = 26/48 (54%), Positives = 33/48 (68%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 ++H N++T G ICLDILKD W+A VLLSI SLL+ PN PL+ Sbjct: 463 IYHCNINTDGNICLDILKDHWSAAITTEKVLLSIHSLLSNPNPMDPLD 510 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 394 TVYAGHKYKLSLEFPNSYPYAPPVCQIYDSLFFIQMLT 507 T Y G + LS++FPN YP+APP + + ++ + T Sbjct: 433 TPYEGGHFVLSVQFPNIYPFAPPKVRFENRIYHCNINT 470 >UniRef50_Q8SSK8 Cluster: UBIQUITIN CONJUGATING ENZYME E2; n=1; Encephalitozoon cuniculi|Rep: UBIQUITIN CONJUGATING ENZYME E2 - Encephalitozoon cuniculi Length = 204 Score = 58.8 bits (136), Expect = 2e-07 Identities = 24/52 (46%), Positives = 33/52 (63%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 PV+HPNV +CLDI+ D+W ++ VL IQ LL PNT+SP N+ + Sbjct: 122 PVYHPNVYPTNQVCLDIIGDRWKPSLNIMNVLCGIQQLLGSPNTRSPANTDA 173 >UniRef50_Q7QVV7 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 159 Score = 58.4 bits (135), Expect = 2e-07 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = +3 Query: 486 VFHPNVDTCGLICLDIL-KDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 ++HPNV G ICLDIL K +W +YD+ TVL SI+SLL +PN + P N Sbjct: 74 IYHPNVYKDGKICLDILTKKEWKPVYDLGTVLTSIRSLLCDPNPKDPAN 122 >UniRef50_A2FS62 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 149 Score = 58.4 bits (135), Expect = 2e-07 Identities = 32/106 (30%), Positives = 49/106 (46%) Frame = +3 Query: 321 KEYQHSLXSENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPN 500 K Y + +N++ W + GP S+ P + + +P FHPN Sbjct: 21 KNYVVTPDPQNIYHWDAVLFGPEDTVWEGANFRMQFDFSEDYPHTCPEVKFVDIP-FHPN 79 Query: 501 VDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 + G IC+DIL+ W+ YD ++ SI SLL PN SP N+ + Sbjct: 80 IYQNGSICIDILQQNWSNAYDAAAIMTSIISLLVLPNPHSPANNEA 125 >UniRef50_A3FPP4 Cluster: Ubiquitin carrier protein; n=1; Cryptosporidium parvum Iowa II|Rep: Ubiquitin carrier protein - Cryptosporidium parvum Iowa II Length = 137 Score = 58.0 bits (134), Expect = 3e-07 Identities = 34/106 (32%), Positives = 52/106 (49%), Gaps = 1/106 (0%) Frame = +3 Query: 315 VIKEYQHSLXSENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFH 494 +I Y S ++ ++ W G I GP S PI + + P+FH Sbjct: 3 IINTYFFSRENDLMY-WDGEIVGPDETPYEGFVFKIEIIVSPQYPILPPSVKFV-TPIFH 60 Query: 495 PNVDT-CGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 PNV+ G +C+D++KD WT + + V +I S+L +PN SPLN Sbjct: 61 PNVNFFTGEVCIDVIKDNWTPAWTLHAVCRAIISILCDPNPNSPLN 106 >UniRef50_Q8SQR1 Cluster: Ubiquitin carrier protein; n=1; Encephalitozoon cuniculi|Rep: Ubiquitin carrier protein - Encephalitozoon cuniculi Length = 175 Score = 58.0 bits (134), Expect = 3e-07 Identities = 28/94 (29%), Positives = 48/94 (51%) Frame = +3 Query: 345 SENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLIC 524 S +LF W + P + S P + ++ P++HPN+++ G+IC Sbjct: 52 SGDLFTWEAYLTAPEESVYKGGIFKLLITFSNEYPFKPPKIT-FQTPIYHPNINSSGMIC 110 Query: 525 LDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 +DIL +W+ + +VLLS+ +LL +PN PL Sbjct: 111 IDILGKEWSPALTLNSVLLSLLTLLDDPNADDPL 144 >UniRef50_A2GLA4 Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin-conjugating enzyme family protein - Trichomonas vaginalis G3 Length = 157 Score = 57.6 bits (133), Expect = 4e-07 Identities = 23/49 (46%), Positives = 33/49 (67%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 P+ HPNVD G +C +IL ++W Y++ T+L+SI L+ EPNT P N Sbjct: 74 PIIHPNVDANGNVCHNILFNEWDPSYNIYTILISIYLLIIEPNTNEPAN 122 >UniRef50_A6NGR2 Cluster: Uncharacterized protein UBE2A (Ubiquitin-conjugating enzyme E2A (RAD6 homolog), isoform CRA_a); n=6; Euteleostomi|Rep: Uncharacterized protein UBE2A (Ubiquitin-conjugating enzyme E2A (RAD6 homolog), isoform CRA_a) - Homo sapiens (Human) Length = 122 Score = 57.6 bits (133), Expect = 4e-07 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +3 Query: 513 GLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 G ICLDIL+++W+ YDV ++L SIQSLL EPN SP NS + Sbjct: 55 GSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQA 96 >UniRef50_Q75AF2 Cluster: NEDD8-conjugating enzyme UBC12; n=2; Eremothecium gossypii|Rep: NEDD8-conjugating enzyme UBC12 - Ashbya gossypii (Yeast) (Eremothecium gossypii) Length = 184 Score = 57.6 bits (133), Expect = 4e-07 Identities = 22/54 (40%), Positives = 36/54 (66%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSSFXT 647 ++HPN+D G ICL++L++ W+ + D++TV+L + L EPN PLN + T Sbjct: 100 IYHPNIDYSGNICLNVLREDWSPVMDLQTVVLGLLFLFLEPNGSDPLNRQAADT 153 >UniRef50_Q96LR5 Cluster: Ubiquitin-conjugating enzyme E2 E2; n=112; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 E2 - Homo sapiens (Human) Length = 201 Score = 57.6 bits (133), Expect = 4e-07 Identities = 32/96 (33%), Positives = 49/96 (51%) Frame = +3 Query: 348 ENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICL 527 +N+++W TI GP + S P + ++ ++H N+++ G+ICL Sbjct: 82 DNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVT-FRTRIYHCNINSQGVICL 140 Query: 528 DILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSS 635 DILKD W+ + VLLSI SLL + N PL S Sbjct: 141 DILKDNWSPALTISKVLLSICSLLTDCNPADPLVGS 176 >UniRef50_UPI0000F2B380 Cluster: PREDICTED: similar to Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b; n=2; Amniota|Rep: PREDICTED: similar to Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b - Monodelphis domestica Length = 270 Score = 57.2 bits (132), Expect = 6e-07 Identities = 30/93 (32%), Positives = 47/93 (50%) Frame = +3 Query: 348 ENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICL 527 +++F W TI GP + P + ++ ++HPN+++ G ICL Sbjct: 151 DDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT-TRIYHPNINSNGSICL 209 Query: 528 DILKDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 DIL+ +W+ + VLLSI SLL +PN PL Sbjct: 210 DILRSQWSPALTISKVLLSICSLLCDPNPDDPL 242 >UniRef50_Q8LGF7 Cluster: Ubiquitin carrier protein; n=7; Eukaryota|Rep: Ubiquitin carrier protein - Arabidopsis thaliana (Mouse-ear cress) Length = 157 Score = 57.2 bits (132), Expect = 6e-07 Identities = 33/97 (34%), Positives = 48/97 (49%), Gaps = 1/97 (1%) Frame = +3 Query: 351 NLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVD-TCGLICL 527 N+FKW I GP + P++ + L +FHPNV G ICL Sbjct: 33 NIFKWTALIKGPSETPYEGGVFQLAFSVPEPYPLQPPQVRFL-TKIFHPNVHFKTGEICL 91 Query: 528 DILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 DILK+ W+ + +++V +I +L+A P SPLN S Sbjct: 92 DILKNAWSPAWTLQSVCRAIIALMAHPEPDSPLNCDS 128 >UniRef50_P62837 Cluster: Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19) (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2); n=169; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19) (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) - Homo sapiens (Human) Length = 147 Score = 57.2 bits (132), Expect = 6e-07 Identities = 30/93 (32%), Positives = 47/93 (50%) Frame = +3 Query: 348 ENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICL 527 +++F W TI GP + P + ++ ++HPN+++ G ICL Sbjct: 28 DDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT-TRIYHPNINSNGSICL 86 Query: 528 DILKDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 DIL+ +W+ + VLLSI SLL +PN PL Sbjct: 87 DILRSQWSPALTISKVLLSICSLLCDPNPDDPL 119 >UniRef50_Q9NPD8 Cluster: Ubiquitin-conjugating enzyme E2 T; n=16; Coelomata|Rep: Ubiquitin-conjugating enzyme E2 T - Homo sapiens (Human) Length = 197 Score = 56.8 bits (131), Expect = 7e-07 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 4/52 (7%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDIL----KDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 P++HPN+D+ G ICLD+L K W ++ TVL SIQ L++EPN PL Sbjct: 73 PIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPL 124 >UniRef50_Q6CSW8 Cluster: NEDD8-conjugating enzyme UBC12; n=1; Kluyveromyces lactis|Rep: NEDD8-conjugating enzyme UBC12 - Kluyveromyces lactis (Yeast) (Candida sphaerica) Length = 184 Score = 56.8 bits (131), Expect = 7e-07 Identities = 20/54 (37%), Positives = 36/54 (66%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSSFXT 647 ++HPN+D G +CL++L++ WT D++++++ I L EPN + PLN + T Sbjct: 100 IYHPNIDIDGNVCLNLLREDWTPALDIQSIIIGILFLFHEPNGRDPLNKDAAKT 153 >UniRef50_Q57XM0 Cluster: Ubiquitin carrier protein; n=1; Trypanosoma brucei|Rep: Ubiquitin carrier protein - Trypanosoma brucei Length = 226 Score = 56.4 bits (130), Expect = 1e-06 Identities = 27/51 (52%), Positives = 33/51 (64%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 +FHPNV G ICLD LKDKW V +VLL I SLL++PN S N+ + Sbjct: 136 IFHPNVYGNGDICLDTLKDKWCPSLSVESVLLMIISLLSDPNPNSAANAEA 186 >UniRef50_Q4DVH2 Cluster: Ubiquitin carrier protein; n=2; Trypanosoma cruzi|Rep: Ubiquitin carrier protein - Trypanosoma cruzi Length = 224 Score = 56.4 bits (130), Expect = 1e-06 Identities = 31/96 (32%), Positives = 45/96 (46%) Frame = +3 Query: 351 NLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICLD 530 +LF W + GP + P + L +FHPNV G ICLD Sbjct: 96 DLFHWRAVVLGPESTVWEGGIFKLQLDFTDEYPCAPPKVRFLTRDMFHPNVYVDGNICLD 155 Query: 531 ILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 LK +W+ + DV ++L+ I SLL++PN S N + Sbjct: 156 TLKTEWSPILDVESLLMMIISLLSDPNPSSAANGEA 191 >UniRef50_A0E347 Cluster: Ubiquitin carrier protein; n=4; Eukaryota|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 197 Score = 56.4 bits (130), Expect = 1e-06 Identities = 23/47 (48%), Positives = 33/47 (70%), Gaps = 1/47 (2%) Frame = +3 Query: 486 VFHPNVDT-CGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSP 623 ++HPN+ + G ICLDILKD+W+ +RT LLS+Q+L +P SP Sbjct: 80 IWHPNISSQTGAICLDILKDQWSPALSIRTALLSLQALFCDPQPDSP 126 >UniRef50_Q16763 Cluster: Ubiquitin-conjugating enzyme E2 S; n=33; Eumetazoa|Rep: Ubiquitin-conjugating enzyme E2 S - Homo sapiens (Human) Length = 222 Score = 56.4 bits (130), Expect = 1e-06 Identities = 25/51 (49%), Positives = 34/51 (66%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 +FHPNV G IC+++LK WTA +R VLL+I+ LL PN +S LN + Sbjct: 83 IFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEA 133 >UniRef50_Q9FI61 Cluster: Ubiquitin carrier protein; n=3; Viridiplantae|Rep: Ubiquitin carrier protein - Arabidopsis thaliana (Mouse-ear cress) Length = 192 Score = 56.0 bits (129), Expect = 1e-06 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 1/94 (1%) Frame = +3 Query: 345 SENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDT-CGLI 521 S+NL + GTI GP+ P + V+HPN+ + G I Sbjct: 29 SDNLTRLTGTIPGPIGTPYEGGTFQIDITMPDGYPFEPPKMQ-FSTKVWHPNISSQSGAI 87 Query: 522 CLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSP 623 CLDILKD+W+ ++T L+SIQ+LL+ P + P Sbjct: 88 CLDILKDQWSPALTLKTALVSIQALLSAPEPKDP 121 >UniRef50_Q43780 Cluster: Ubiquitin carrier protein; n=15; Eukaryota|Rep: Ubiquitin carrier protein - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) Length = 194 Score = 56.0 bits (129), Expect = 1e-06 Identities = 33/97 (34%), Positives = 48/97 (49%), Gaps = 1/97 (1%) Frame = +3 Query: 336 SLXSENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDT-C 512 +L ++L IGTI GP+ + P + V+HPN+ + Sbjct: 26 TLKGDSLTHLIGTIPGPVGTPYEGGTFKIDITLTDGYPFEPPKMKFA-TKVWHPNISSQS 84 Query: 513 GLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSP 623 G ICLDILKD+W+ ++T LLSIQ+LL+ P P Sbjct: 85 GAICLDILKDQWSPALTLKTALLSIQALLSAPEPDDP 121 >UniRef50_Q5CQL8 Cluster: Ubiquitin carrier protein; n=2; Cryptosporidium|Rep: Ubiquitin carrier protein - Cryptosporidium parvum Iowa II Length = 197 Score = 55.6 bits (128), Expect = 2e-06 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 1/47 (2%) Frame = +3 Query: 486 VFHPNVDT-CGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSP 623 ++HPN+ + G ICLDILKD W+ +RTV+LSIQ+LL+ P P Sbjct: 79 IWHPNISSQTGAICLDILKDAWSPALTLRTVMLSIQALLSSPEPNDP 125 >UniRef50_Q4PH88 Cluster: Ubiquitin carrier protein; n=3; Dikarya|Rep: Ubiquitin carrier protein - Ustilago maydis (Smut fungus) Length = 227 Score = 55.6 bits (128), Expect = 2e-06 Identities = 31/99 (31%), Positives = 50/99 (50%), Gaps = 1/99 (1%) Frame = +3 Query: 330 QHSLXSENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDT 509 Q SL E+ F +GT GP + + P + + + V+HPN+ + Sbjct: 25 QVSLIDESPFHLVGTFPGPENSPYEKGTFDVDIVVPEGYPFQPIKMKFI-TRVYHPNISS 83 Query: 510 -CGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSP 623 G ICLDILKD+W+ + +++ L+S++SLL P P Sbjct: 84 QSGAICLDILKDQWSPVLTLKSTLMSLRSLLCSPEPNDP 122 >UniRef50_P61086 Cluster: Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier protein) (E2(25K)); n=43; Eumetazoa|Rep: Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier protein) (E2(25K)) - Homo sapiens (Human) Length = 200 Score = 55.6 bits (128), Expect = 2e-06 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 1/47 (2%) Frame = +3 Query: 486 VFHPNVDTC-GLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSP 623 ++HPN+ + G ICLDILKD+W A +RTVLLS+Q+LLA P Sbjct: 79 IWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDP 125 >UniRef50_UPI0000ECA0A1 Cluster: Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19) (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T).; n=3; Amniota|Rep: Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19) (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T). - Gallus gallus Length = 158 Score = 55.2 bits (127), Expect = 2e-06 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 4/52 (7%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDIL----KDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 P++HPN+D+ G ICLD+L K W ++ T+L SIQ L+ EPN PL Sbjct: 37 PIYHPNIDSAGRICLDVLKLPPKGAWRPSLNISTLLTSIQLLMVEPNPDDPL 88 >UniRef50_Q9VYN3 Cluster: Ubiquitin carrier protein; n=2; Sophophora|Rep: Ubiquitin carrier protein - Drosophila melanogaster (Fruit fly) Length = 239 Score = 55.2 bits (127), Expect = 2e-06 Identities = 29/92 (31%), Positives = 45/92 (48%) Frame = +3 Query: 351 NLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICLD 530 +L W +NGP+ + P R + ++H NVD+ G ICLD Sbjct: 90 DLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRI-RFTTRIYHCNVDSRGAICLD 148 Query: 531 ILKDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 +L ++W+ + +V VLLSI L++E N PL Sbjct: 149 VLGERWSPVMNVAKVLLSIYVLMSECNPDDPL 180 >UniRef50_A6RUK1 Cluster: Ubiquitin carrier protein; n=2; Sclerotiniaceae|Rep: Ubiquitin carrier protein - Botryotinia fuckeliana B05.10 Length = 185 Score = 55.2 bits (127), Expect = 2e-06 Identities = 19/51 (37%), Positives = 34/51 (66%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 ++HPN+D G ICL+IL++ W + +++ +++ +Q L EPN PLN + Sbjct: 100 IYHPNIDVEGKICLNILREDWKPVLNLQAIVIGLQFLFLEPNASDPLNKEA 150 >UniRef50_A2QG50 Cluster: Ubiquitin carrier protein; n=1; Aspergillus niger|Rep: Ubiquitin carrier protein - Aspergillus niger Length = 185 Score = 55.2 bits (127), Expect = 2e-06 Identities = 30/87 (34%), Positives = 46/87 (52%) Frame = +3 Query: 348 ENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICL 527 ++LF IGTI GP+ + P + + ++HPNV G +CL Sbjct: 59 DHLFDIIGTIAGPVGSPYEGGIFHIHIRIPALYPDLPPICTFM-TKIWHPNVGPYGEVCL 117 Query: 528 DILKDKWTALYDVRTVLLSIQSLLAEP 608 +IL+D+W+ VRTVLLSI ++L +P Sbjct: 118 NILQDEWSQALSVRTVLLSISAMLGDP 144 >UniRef50_Q4QBT6 Cluster: Ubiquitin-conjugating enzyme-like protein; n=3; Leishmania|Rep: Ubiquitin-conjugating enzyme-like protein - Leishmania major Length = 260 Score = 54.8 bits (126), Expect = 3e-06 Identities = 24/51 (47%), Positives = 34/51 (66%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 VFHPNV G IC+D LK W + ++ +L+SIQSLL++PN S N ++ Sbjct: 167 VFHPNVYVDGNICMDTLKSSWQSSLNLEALLISIQSLLSDPNPLSAANGAA 217 >UniRef50_A2GNR9 Cluster: Ubiquitin conjugating protein, putative; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin conjugating protein, putative - Trichomonas vaginalis G3 Length = 151 Score = 54.8 bits (126), Expect = 3e-06 Identities = 27/49 (55%), Positives = 32/49 (65%), Gaps = 1/49 (2%) Frame = +3 Query: 486 VFHPNV-DTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 VFHPNV T ICLDIL+ W+ Y+V +LLSIQ LL EPN + N Sbjct: 74 VFHPNVFPTTQEICLDILRRNWSPAYNVSAILLSIQQLLTEPNPAANAN 122 >UniRef50_P62256 Cluster: Ubiquitin-conjugating enzyme E2 H; n=51; Eumetazoa|Rep: Ubiquitin-conjugating enzyme E2 H - Homo sapiens (Human) Length = 183 Score = 54.8 bits (126), Expect = 3e-06 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 2/53 (3%) Frame = +3 Query: 486 VFHPNVDTC-GLICLDILKDKWTALYDVRTVLLS-IQSLLAEPNTQSPLNSSS 638 +FHPN+D G +CLD++ WTALYD+ + S + LLA PN PLN + Sbjct: 74 IFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDA 126 >UniRef50_P52491 Cluster: NEDD8-conjugating enzyme UBC12; n=3; Saccharomycetales|Rep: NEDD8-conjugating enzyme UBC12 - Saccharomyces cerevisiae (Baker's yeast) Length = 188 Score = 54.8 bits (126), Expect = 3e-06 Identities = 22/64 (34%), Positives = 37/64 (57%) Frame = +3 Query: 447 PIRTTCLSNL*LPVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 P + CL +FHPN+D G +CL+IL++ W+ D+++++ + L EPN PL Sbjct: 94 PPKVVCLKK----IFHPNIDLKGNVCLNILREDWSPALDLQSIITGLLFLFLEPNPNDPL 149 Query: 627 NSSS 638 N + Sbjct: 150 NKDA 153 >UniRef50_Q6C9W0 Cluster: NEDD8-conjugating enzyme UBC12; n=41; Eukaryota|Rep: NEDD8-conjugating enzyme UBC12 - Yarrowia lipolytica (Candida lipolytica) Length = 179 Score = 54.8 bits (126), Expect = 3e-06 Identities = 23/64 (35%), Positives = 36/64 (56%) Frame = +3 Query: 447 PIRTTCLSNL*LPVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 P + CL V+HPN+D G +CL+IL++ W + + V++ +Q L EPN PL Sbjct: 85 PPKVKCLQK----VYHPNIDLEGNVCLNILREDWKPVLSLNAVMIGLQYLFLEPNASDPL 140 Query: 627 NSSS 638 N + Sbjct: 141 NKDA 144 >UniRef50_Q8I4X8 Cluster: Ubiquitin carrier protein; n=2; Plasmodium|Rep: Ubiquitin carrier protein - Plasmodium falciparum (isolate 3D7) Length = 157 Score = 54.4 bits (125), Expect = 4e-06 Identities = 23/61 (37%), Positives = 38/61 (62%) Frame = +3 Query: 447 PIRTTCLSNL*LPVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 P + CLS +FHPN+D G +CL++LK +W + +++ ++L + LL EP+T P Sbjct: 71 PPKIICLSK----IFHPNIDESGNVCLNVLKLEWNPIINLQMLILGLLLLLDEPSTDDPF 126 Query: 627 N 629 N Sbjct: 127 N 127 >UniRef50_Q4QIK2 Cluster: Ubiquitin carrier protein; n=6; Trypanosomatidae|Rep: Ubiquitin carrier protein - Leishmania major Length = 182 Score = 54.4 bits (125), Expect = 4e-06 Identities = 24/49 (48%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = +3 Query: 486 VFHPNVD-TCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 VFHPNV+ G +CLDILK +W+ ++ + +V +I +LLAEP + SP N Sbjct: 97 VFHPNVEFNTGNVCLDILKKRWSPVWTLSSVCRAILNLLAEPESDSPFN 145 >UniRef50_A5DY26 Cluster: Ubiquitin carrier protein; n=3; Saccharomycetaceae|Rep: Ubiquitin carrier protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 211 Score = 54.4 bits (125), Expect = 4e-06 Identities = 20/51 (39%), Positives = 33/51 (64%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 ++HPN+D G ICL+IL++ W+ + + +VL+ + L EPN PLN + Sbjct: 128 IYHPNIDLQGNICLNILREDWSPVLSLNSVLIGLNFLFLEPNPNDPLNKEA 178 >UniRef50_Q5UQC9 Cluster: Probable ubiquitin-conjugating enzyme E2 L460; n=1; Acanthamoeba polyphaga mimivirus|Rep: Probable ubiquitin-conjugating enzyme E2 L460 - Mimivirus Length = 158 Score = 54.4 bits (125), Expect = 4e-06 Identities = 33/103 (32%), Positives = 51/103 (49%), Gaps = 1/103 (0%) Frame = +3 Query: 327 YQHSLXSENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVD 506 +Q ++ EN+F W I GP + S P + + + P+ H NV+ Sbjct: 27 FQINMVDENIFLWKVNIKGPENSLYENYNFELEIELSNDYPYSSPKVKFI-TPIQHMNVN 85 Query: 507 TCGLICLDILK-DKWTALYDVRTVLLSIQSLLAEPNTQSPLNS 632 G ICL+ILK D W A ++ +++ SI LL +PN + P NS Sbjct: 86 DKGDICLNILKKDGWNASLNIISIIWSIIVLLDQPNPEDPFNS 128 >UniRef50_Q4SUR6 Cluster: Ubiquitin carrier protein; n=1; Tetraodon nigroviridis|Rep: Ubiquitin carrier protein - Tetraodon nigroviridis (Green puffer) Length = 226 Score = 54.0 bits (124), Expect = 5e-06 Identities = 19/51 (37%), Positives = 33/51 (64%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 V+HPN+D G +CL+IL++ W + + +++ +Q L EPN + PLN + Sbjct: 142 VYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEA 192 >UniRef50_Q9LQI1 Cluster: F15O4.3; n=1; Arabidopsis thaliana|Rep: F15O4.3 - Arabidopsis thaliana (Mouse-ear cress) Length = 123 Score = 54.0 bits (124), Expect = 5e-06 Identities = 27/54 (50%), Positives = 34/54 (62%), Gaps = 6/54 (11%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDILKDKWT------ALYDVRTVLLSIQSLLAEPNTQSPL 626 P++H N+ + G IC+DILKDKWT L + VLLSI LLA+PN PL Sbjct: 54 PIYHSNIKSSGSICIDILKDKWTPSLTVEKLINKSHVLLSITVLLADPNPNDPL 107 >UniRef50_Q54TI6 Cluster: Ubiquitin carrier protein; n=1; Dictyostelium discoideum AX4|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 230 Score = 54.0 bits (124), Expect = 5e-06 Identities = 20/51 (39%), Positives = 32/51 (62%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 V+HPN+D G +CL+IL+ W + ++ TV+ + +L EPN PLN + Sbjct: 147 VYHPNIDLEGHVCLNILRQDWMPVLNIGTVIFGLMTLFLEPNPDDPLNKDA 197 >UniRef50_A0CH05 Cluster: Chromosome undetermined scaffold_18, whole genome shotgun sequence; n=3; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_18, whole genome shotgun sequence - Paramecium tetraurelia Length = 562 Score = 54.0 bits (124), Expect = 5e-06 Identities = 24/49 (48%), Positives = 34/49 (69%), Gaps = 1/49 (2%) Frame = +3 Query: 492 HPNVDTC-GLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSS 635 HPN+ G +CLD+LKD+W+ V +VLLSI+SLL +PN L+S+ Sbjct: 453 HPNISKASGAVCLDVLKDQWSPALSVFSVLLSIRSLLIDPNPDDALDSN 501 >UniRef50_O74549 Cluster: NEDD8-conjugating enzyme ubc12; n=10; Dikarya|Rep: NEDD8-conjugating enzyme ubc12 - Schizosaccharomyces pombe (Fission yeast) Length = 177 Score = 54.0 bits (124), Expect = 5e-06 Identities = 21/64 (32%), Positives = 38/64 (59%) Frame = +3 Query: 447 PIRTTCLSNL*LPVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 P + CL+ ++HPN+D G +CL+IL+ W + ++ ++L+ +Q L PN + PL Sbjct: 84 PPKVKCLNK----IYHPNIDIEGNVCLNILRQDWNPVLNLNSILVGLQFLFLSPNAEDPL 139 Query: 627 NSSS 638 N + Sbjct: 140 NKEA 143 >UniRef50_P61081 Cluster: NEDD8-conjugating enzyme Ubc12; n=24; Eukaryota|Rep: NEDD8-conjugating enzyme Ubc12 - Homo sapiens (Human) Length = 183 Score = 54.0 bits (124), Expect = 5e-06 Identities = 19/51 (37%), Positives = 33/51 (64%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 V+HPN+D G +CL+IL++ W + + +++ +Q L EPN + PLN + Sbjct: 99 VYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEA 149 >UniRef50_UPI00006CC0C2 Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin-conjugating enzyme family protein - Tetrahymena thermophila SB210 Length = 579 Score = 53.2 bits (122), Expect = 9e-06 Identities = 21/51 (41%), Positives = 34/51 (66%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSS 635 P++HPN+ + G +CLDILKD+W+ ++ L S SL+ +PN L+S+ Sbjct: 464 PIYHPNISSQGHMCLDILKDQWSPALTIQKSLNSFLSLMQDPNPNDALDST 514 >UniRef50_UPI0000498C2E Cluster: ubiquitin-conjugating enzyme; n=3; Entamoeba histolytica HM-1:IMSS|Rep: ubiquitin-conjugating enzyme - Entamoeba histolytica HM-1:IMSS Length = 161 Score = 53.2 bits (122), Expect = 9e-06 Identities = 24/49 (48%), Positives = 31/49 (63%), Gaps = 1/49 (2%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDK-WTALYDVRTVLLSIQSLLAEPNTQSPLN 629 V+HPN+ G ICLD LK + W + +VL +IQ LLA PN + PLN Sbjct: 84 VYHPNISFFGKICLDTLKPQGWVCAMQISSVLQTIQQLLANPNLEDPLN 132 >UniRef50_Q0R0E6 Cluster: Ubiquitin carrier protein; n=1; Symbiodinium sp. C3|Rep: Ubiquitin carrier protein - Symbiodinium sp. C3 Length = 268 Score = 53.2 bits (122), Expect = 9e-06 Identities = 24/47 (51%), Positives = 32/47 (68%) Frame = +3 Query: 471 NL*LPVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPN 611 N P++H NV+T G ICLDILKD W+ V L SI++L+A+PN Sbjct: 193 NFHTPIYHCNVNTNGAICLDILKDSWSPSLSVFKCLESIRALMADPN 239 >UniRef50_Q7QVX4 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 192 Score = 53.2 bits (122), Expect = 9e-06 Identities = 23/52 (44%), Positives = 31/52 (59%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSSF 641 +FHPNV G +CL IL +W ++ +LL +Q LL EPN QSP +F Sbjct: 86 LFHPNVYPSGSVCLSILSYEWKPSITIKEILLGLQVLLDEPNLQSPAQHEAF 137 >UniRef50_P63279 Cluster: SUMO-conjugating enzyme UBC9; n=74; Eukaryota|Rep: SUMO-conjugating enzyme UBC9 - Homo sapiens (Human) Length = 158 Score = 53.2 bits (122), Expect = 9e-06 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 2/55 (3%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDILK-DK-WTALYDVRTVLLSIQSLLAEPNTQSPLNSSSF 641 P+FHPNV G +CL IL+ DK W ++ +LL IQ LL EPN Q P + ++ Sbjct: 80 PLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAY 134 >UniRef50_Q9N2W9 Cluster: Ubiquitin carrier protein; n=1; Caenorhabditis elegans|Rep: Ubiquitin carrier protein - Caenorhabditis elegans Length = 221 Score = 52.8 bits (121), Expect = 1e-05 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Frame = +3 Query: 486 VFHPNVDTC-GLICLDILKDKWTALYDVRTVL-LSIQSLLAEPNTQSPLNSSS 638 +FHPN+D G +CLD++ WTALYD+ + + LL PN PLN + Sbjct: 75 IFHPNIDEASGTVCLDVINQAWTALYDLTNIFDTFLPQLLTYPNAADPLNGEA 127 >UniRef50_Q6LFK4 Cluster: Ubiquitin-conjugating enzyme E2, putative; n=5; Plasmodium|Rep: Ubiquitin-conjugating enzyme E2, putative - Plasmodium falciparum (isolate 3D7) Length = 155 Score = 52.8 bits (121), Expect = 1e-05 Identities = 29/94 (30%), Positives = 45/94 (47%), Gaps = 1/94 (1%) Frame = +3 Query: 351 NLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVD-TCGLICL 527 NL++W I GP + PI ++ + FHPNV+ G +C+ Sbjct: 29 NLYEWQAVIRGPKDSPYEGGKWKLNIKCKSTYPIDPPLITFV-TKFFHPNVNFVTGELCM 87 Query: 528 DILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 DILK W+ + ++++ +I L EPN SPLN Sbjct: 88 DILKANWSPAWTIQSLCRAILFLFNEPNADSPLN 121 >UniRef50_Q54IK3 Cluster: Ubiquitin carrier protein; n=1; Dictyostelium discoideum AX4|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 585 Score = 52.8 bits (121), Expect = 1e-05 Identities = 22/48 (45%), Positives = 30/48 (62%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 ++H N++ G ICLDILKD W+ + V+LSI LL PN PL+ Sbjct: 498 IYHCNINNDGNICLDILKDSWSPALTISKVMLSISQLLVTPNPHDPLD 545 >UniRef50_Q54F00 Cluster: Ubiquitin carrier protein; n=3; Eukaryota|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 292 Score = 52.8 bits (121), Expect = 1e-05 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 4/52 (7%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDILK----DKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 P++HPN+DT G ICLDILK +W ++ T+L SI+ L++ PN PL Sbjct: 81 PIYHPNIDTNGRICLDILKMPPSGEWKPSLNLLTILTSIRLLMSNPNPYDPL 132 >UniRef50_Q4Y3H7 Cluster: Ubiquitin carrier protein; n=1; Plasmodium chabaudi|Rep: Ubiquitin carrier protein - Plasmodium chabaudi Length = 118 Score = 52.8 bits (121), Expect = 1e-05 Identities = 22/64 (34%), Positives = 40/64 (62%) Frame = +3 Query: 447 PIRTTCLSNL*LPVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 P + +CL+ +FHPN+D G +CL++LK W + +++ ++L + LL EP+T P Sbjct: 36 PPKISCLNK----IFHPNIDENGNVCLNVLKLDWNPIINLQMLILGLILLLNEPSTNDPF 91 Query: 627 NSSS 638 N+ + Sbjct: 92 NADA 95 >UniRef50_Q6CPL4 Cluster: Kluyveromyces lactis strain NRRL Y-1140 chromosome E of strain NRRL Y- 1140 of Kluyveromyces lactis; n=1; Kluyveromyces lactis|Rep: Kluyveromyces lactis strain NRRL Y-1140 chromosome E of strain NRRL Y- 1140 of Kluyveromyces lactis - Kluyveromyces lactis (Yeast) (Candida sphaerica) Length = 158 Score = 52.4 bits (120), Expect = 2e-05 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 2/50 (4%) Frame = +3 Query: 486 VFHPNV--DTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 V HPNV DT G ICLD+LKD WT +Y + V+ +I+ LLA+P SPL+ Sbjct: 80 VAHPNVKWDT-GEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLD 128 >UniRef50_Q4WNS9 Cluster: Ubiquitin carrier protein; n=4; Ascomycota|Rep: Ubiquitin carrier protein - Aspergillus fumigatus (Sartorya fumigata) Length = 190 Score = 52.4 bits (120), Expect = 2e-05 Identities = 22/55 (40%), Positives = 34/55 (61%), Gaps = 2/55 (3%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDILKDK--WTALYDVRTVLLSIQSLLAEPNTQSPLNSSSF 641 P+FHPNV G +CL IL ++ W ++ +LL IQ LL +PN +SP + ++ Sbjct: 112 PLFHPNVYPSGTVCLSILNEEEAWKPAITIKQILLGIQDLLDDPNPESPAQAEAY 166 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 394 TVYAGHKYKLSLEFPNSYPYAPPVCQIYDSLF 489 T++ G +KL + FP+ YP PP C+ LF Sbjct: 83 TLWEGGLFKLDVVFPDEYPTKPPKCKFVPPLF 114 >UniRef50_A7TRY4 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 192 Score = 52.4 bits (120), Expect = 2e-05 Identities = 19/51 (37%), Positives = 33/51 (64%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 +FHPN+D G ICL+IL++ W+ D+ ++++ + L E N + PLN + Sbjct: 109 IFHPNIDLDGKICLNILREDWSPALDLNSIIIGLLYLFLECNAKDPLNKEA 159 >UniRef50_A7TMT8 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 223 Score = 52.4 bits (120), Expect = 2e-05 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 2/53 (3%) Frame = +3 Query: 486 VFHPNVDTC-GLICLDILKDKWTALYDVRTVL-LSIQSLLAEPNTQSPLNSSS 638 +FHPN+D G ICLD++ W+ LYD+ ++ I LL EPN PLN+ + Sbjct: 73 IFHPNIDIASGSICLDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEA 125 >UniRef50_A5E394 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 199 Score = 52.4 bits (120), Expect = 2e-05 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 1/50 (2%) Frame = +3 Query: 483 PVFHPNVDT-CGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 P+ HPNVD G ICLDILK +W+ +++ +++++I L+ P SPLN Sbjct: 82 PIIHPNVDLKLGEICLDILKSQWSPAWNLESLVVAILQLMDHPEPDSPLN 131 >UniRef50_P28263 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa; n=13; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-24 kDa - Saccharomyces cerevisiae (Baker's yeast) Length = 218 Score = 52.4 bits (120), Expect = 2e-05 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 2/53 (3%) Frame = +3 Query: 486 VFHPNVDTC-GLICLDILKDKWTALYD-VRTVLLSIQSLLAEPNTQSPLNSSS 638 +FHPN+D G ICLD++ W+ LYD + V I LL EPN PLN+ + Sbjct: 72 IFHPNIDIASGSICLDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEA 124 >UniRef50_A2WYK3 Cluster: Ubiquitin carrier protein; n=2; Oryza sativa|Rep: Ubiquitin carrier protein - Oryza sativa subsp. indica (Rice) Length = 195 Score = 52.0 bits (119), Expect = 2e-05 Identities = 23/47 (48%), Positives = 33/47 (70%), Gaps = 1/47 (2%) Frame = +3 Query: 486 VFHPNVDTC-GLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSP 623 V+HPN+ + G ICLDILKD+W+ ++T LLS+Q+LL+ P P Sbjct: 76 VWHPNISSQNGAICLDILKDQWSPALTLKTALLSLQALLSAPAPDDP 122 >UniRef50_A2DXW4 Cluster: Ubiquitin carrier protein; n=2; Trichomonas vaginalis|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 164 Score = 52.0 bits (119), Expect = 2e-05 Identities = 21/51 (41%), Positives = 31/51 (60%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 V+HPN+D G +CL IL+D + A + + +Q L EPN SPLN+ + Sbjct: 89 VWHPNIDENGAVCLSILRDNYLATLSISQFVAGLQYLFIEPNPNSPLNTEA 139 >UniRef50_A0C0C6 Cluster: Chromosome undetermined scaffold_14, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_14, whole genome shotgun sequence - Paramecium tetraurelia Length = 150 Score = 52.0 bits (119), Expect = 2e-05 Identities = 31/97 (31%), Positives = 47/97 (48%), Gaps = 1/97 (1%) Frame = +3 Query: 339 LXSENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVD-TCG 515 L NLF W +GP + + P+++ + L ++H N+D G Sbjct: 27 LDDNNLFHWKICFSGPQGSSYENGNFTLDVLFPEDYPLKSPKILFL-TSIYHLNIDYNTG 85 Query: 516 LICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 ICL+IL W+ +R +LLSI +LL +PN SPL Sbjct: 86 QICLEILGQNWSPNLTIRKLLLSILALLYDPNPNSPL 122 >UniRef50_Q4PBN3 Cluster: Ubiquitin carrier protein; n=1; Ustilago maydis|Rep: Ubiquitin carrier protein - Ustilago maydis (Smut fungus) Length = 269 Score = 52.0 bits (119), Expect = 2e-05 Identities = 22/52 (42%), Positives = 31/52 (59%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 P+FHPNV G IC+ LK W Y + +L +I+ LL EPN S L++ + Sbjct: 133 PIFHPNVSRSGDICVSSLKKDWKKEYGIERILTTIKCLLIEPNPDSALDAEA 184 >UniRef50_UPI00015B62F0 Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 154 Score = 51.6 bits (118), Expect = 3e-05 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 4/52 (7%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDILK----DKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 PV+HPN+DT G IC+D+LK W + +++++QSLL PN PL Sbjct: 72 PVYHPNIDTQGRICMDLLKMPPNGGWKPTISLENLIVAVQSLLGNPNPDDPL 123 >UniRef50_UPI00006CB812 Cluster: Ubiquitin-conjugating enzyme family protein; n=2; Tetrahymena thermophila SB210|Rep: Ubiquitin-conjugating enzyme family protein - Tetrahymena thermophila SB210 Length = 901 Score = 51.6 bits (118), Expect = 3e-05 Identities = 30/99 (30%), Positives = 48/99 (48%), Gaps = 2/99 (2%) Frame = +3 Query: 339 LXSEN-LFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVD-TC 512 L EN +FKW I GP + PI+ + +FHPN+ Sbjct: 760 LFDENDIFKWKAFIVGPEDSPYSDGIFELGINLPSNYPIQAPQVI-FKTRIFHPNIHWET 818 Query: 513 GLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 G ICL+++KD+W+ + + + ++Q L++ PN SPLN Sbjct: 819 GEICLNVVKDEWSPYWTLEALCRAVQQLMSNPNADSPLN 857 >UniRef50_A2FAR7 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 162 Score = 51.6 bits (118), Expect = 3e-05 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 1/50 (2%) Frame = +3 Query: 486 VFHPNVD-TCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNS 632 +FHPN+ G ICLDILK +WT + + ++ +I+ LL+ P SPLN+ Sbjct: 74 IFHPNISFKDGTICLDILKTEWTPAWTINSLCTAIRLLLSHPEPDSPLNT 123 >UniRef50_Q22BX5 Cluster: Ubiquitin carrier protein; n=5; Tetrahymena thermophila SB210|Rep: Ubiquitin carrier protein - Tetrahymena thermophila SB210 Length = 549 Score = 51.2 bits (117), Expect = 4e-05 Identities = 22/48 (45%), Positives = 31/48 (64%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 + HPN+ G ICL+IL+DKW+ + ++ VL+SI SLL E N N Sbjct: 430 ILHPNISESGEICLNILQDKWSTVLTIQKVLVSIVSLLYEKNLDDVYN 477 >UniRef50_A0C3F7 Cluster: Ubiquitin carrier protein; n=2; Paramecium tetraurelia|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 167 Score = 51.2 bits (117), Expect = 4e-05 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 2/50 (4%) Frame = +3 Query: 486 VFHPNV--DTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 +FHPNV DT G +CL++L KW + + +VL +++ +L EPN SPLN Sbjct: 74 IFHPNVHMDT-GEVCLEVLSQKWEPRWTIESVLRAVRLMLQEPNPYSPLN 122 >UniRef50_Q9LV54 Cluster: Ubiquitin carrier protein; n=2; Arabidopsis thaliana|Rep: Ubiquitin carrier protein - Arabidopsis thaliana (Mouse-ear cress) Length = 409 Score = 50.8 bits (116), Expect = 5e-05 Identities = 24/52 (46%), Positives = 32/52 (61%), Gaps = 4/52 (7%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDIL----KDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 P++HPN+D G ICLDIL K W ++ TVL S++ LL+EPN L Sbjct: 86 PIYHPNIDNSGRICLDILNLPPKGAWQPSLNISTVLTSMRLLLSEPNPDDGL 137 >UniRef50_Q4Q3Q8 Cluster: Ubiquitin carrier protein; n=4; Leishmania|Rep: Ubiquitin carrier protein - Leishmania major Length = 243 Score = 50.8 bits (116), Expect = 5e-05 Identities = 21/51 (41%), Positives = 33/51 (64%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 +FHPN+ G IC++ LK W+ + +R +L+ I+ LL EPN +S LN + Sbjct: 77 IFHPNISERGDICVNTLKRDWSPMLGLRHILVVIRCLLIEPNPESALNEEA 127 >UniRef50_Q7KNM2 Cluster: Ubiquitin carrier protein; n=39; Eukaryota|Rep: Ubiquitin carrier protein - Drosophila melanogaster (Fruit fly) Length = 159 Score = 50.4 bits (115), Expect = 6e-05 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 2/55 (3%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDILKDK--WTALYDVRTVLLSIQSLLAEPNTQSPLNSSSF 641 P+FHPNV G +CL +L ++ W ++ +LL IQ LL EPN + P + ++ Sbjct: 80 PLFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLLNEPNIKDPAQAEAY 134 >UniRef50_Q54I43 Cluster: Ubiquitin carrier protein; n=3; Eukaryota|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 215 Score = 50.4 bits (115), Expect = 6e-05 Identities = 23/57 (40%), Positives = 34/57 (59%) Frame = +3 Query: 468 SNL*LPVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 +N +FHPNV G IC++ LK WT ++ +LL+I+ LL PN +S LN + Sbjct: 75 ANFITKIFHPNVSKKGEICVNTLKKDWTEDLGLKHILLTIKCLLIVPNAESSLNEDA 131 >UniRef50_A7RL90 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 209 Score = 50.4 bits (115), Expect = 6e-05 Identities = 23/52 (44%), Positives = 32/52 (61%), Gaps = 4/52 (7%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDIL----KDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 P++HPN+D+ G ICLD L K W ++ +VL +I L+AEPN PL Sbjct: 74 PIYHPNIDSSGRICLDTLKMPPKGMWKPALNISSVLSTILILMAEPNPDDPL 125 >UniRef50_A4RG25 Cluster: Putative uncharacterized protein; n=4; Sordariomycetes|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 166 Score = 50.4 bits (115), Expect = 6e-05 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 1/50 (2%) Frame = +3 Query: 483 PVFHPNVDTC-GLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 PV H NV+ G +CLD+LK+ WT Y V + +++ LLA P SPLN Sbjct: 84 PVVHANVNLADGEVCLDLLKEAWTPAYSVLETVRAVRLLLATPEPDSPLN 133 >UniRef50_A2E5I6 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 162 Score = 50.0 bits (114), Expect = 8e-05 Identities = 20/48 (41%), Positives = 31/48 (64%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 ++HPN+ G +CL+IL++K+T + ++L IQ L EPN PLN Sbjct: 82 LWHPNIQLYGPVCLNILREKYTPAIPLSNLILGIQYLFLEPNPNDPLN 129 >UniRef50_Q8SRC0 Cluster: Ubiquitin carrier protein; n=1; Encephalitozoon cuniculi|Rep: Ubiquitin carrier protein - Encephalitozoon cuniculi Length = 171 Score = 50.0 bits (114), Expect = 8e-05 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 2/50 (4%) Frame = +3 Query: 486 VFHPNVDTC-GLICLDILKDKWTALYDVRTVL-LSIQSLLAEPNTQSPLN 629 +FHPNVD G ICLD+L W+ +YD+ ++ + + LL+ PN PLN Sbjct: 72 IFHPNVDEASGSICLDVLNQIWSPIYDLLNIVDILLPQLLSYPNAADPLN 121 >UniRef50_Q5KIQ6 Cluster: Ubiquitin carrier protein; n=1; Filobasidiella neoformans|Rep: Ubiquitin carrier protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 260 Score = 50.0 bits (114), Expect = 8e-05 Identities = 22/47 (46%), Positives = 30/47 (63%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 V+H NV + G ICLD+LK W+ + V+LS+ SLL +PN PL Sbjct: 83 VYHCNVASNGAICLDLLKTAWSPALSLYKVILSLSSLLTDPNPADPL 129 >UniRef50_Q5A7Q5 Cluster: Ubiquitin carrier protein; n=2; Ascomycota|Rep: Ubiquitin carrier protein - Candida albicans (Yeast) Length = 194 Score = 50.0 bits (114), Expect = 8e-05 Identities = 18/51 (35%), Positives = 31/51 (60%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 ++HPN+D G ICL+IL++ W+ + + V + + L +PN PLN + Sbjct: 111 IYHPNIDLQGNICLNILREDWSPVLSLTGVFMGLNFLFLDPNATDPLNKDA 161 >UniRef50_Q4PGW5 Cluster: Ubiquitin carrier protein; n=2; Basidiomycota|Rep: Ubiquitin carrier protein - Ustilago maydis (Smut fungus) Length = 458 Score = 50.0 bits (114), Expect = 8e-05 Identities = 28/97 (28%), Positives = 45/97 (46%), Gaps = 1/97 (1%) Frame = +3 Query: 348 ENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICL 527 +N++KW+ + GP + P ++ + ++HPN+D G +C+ Sbjct: 29 DNIYKWVARLKGPAKSPYAGGTFLVDMDFPIEYPFKSPKVK-FNTRIYHPNIDESGNLCV 87 Query: 528 DILK-DKWTALYDVRTVLLSIQSLLAEPNTQSPLNSS 635 ILK + W T+LLSI LL EPN L +S Sbjct: 88 GILKSEAWKPSTKAVTILLSILQLLDEPNADDALVAS 124 >UniRef50_A7RLE1 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 178 Score = 49.6 bits (113), Expect = 1e-04 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 2/55 (3%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDIL-KDK-WTALYDVRTVLLSIQSLLAEPNTQSPLNSSSF 641 P+ HPNV T G +CL ++ K+K W + VL IQ LLA+PN Q P + +F Sbjct: 87 PILHPNVFTSGTVCLSLIDKNKDWKPQVTAQQVLTGIQLLLADPNFQEPAQAEAF 141 Score = 35.9 bits (79), Expect = 1.5 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 394 TVYAGHKYKLSLEFPNSYPYAPPVCQI 474 T + G Y ++LEFP+ YP++PP C++ Sbjct: 55 TPWEGGLYPITLEFPHDYPHSPPKCKL 81 >UniRef50_A0CVS4 Cluster: Chromosome undetermined scaffold_295, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_295, whole genome shotgun sequence - Paramecium tetraurelia Length = 152 Score = 49.6 bits (113), Expect = 1e-04 Identities = 21/42 (50%), Positives = 28/42 (66%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPN 611 +FHPN++ G I L ILKD WT+ Y V +L SI+ LL P+ Sbjct: 76 IFHPNINVLGYIYLGILKDDWTSDYTVHKILTSIKQLLKNPD 117 >UniRef50_Q55U75 Cluster: Ubiquitin carrier protein; n=2; Filobasidiella neoformans|Rep: Ubiquitin carrier protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 246 Score = 49.6 bits (113), Expect = 1e-04 Identities = 22/51 (43%), Positives = 31/51 (60%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 +FHPN+ G IC+D LK W Y V VL++I+ LL PN +S L+ + Sbjct: 78 IFHPNISKSGEICVDTLKKGWKKEYGVGHVLITIKCLLIFPNPESALDEEA 128 >UniRef50_P21734 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa; n=13; Ascomycota|Rep: Ubiquitin-conjugating enzyme E2-24 kDa - Saccharomyces cerevisiae (Baker's yeast) Length = 215 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/47 (42%), Positives = 32/47 (68%), Gaps = 1/47 (2%) Frame = +3 Query: 486 VFHPNVDTC-GLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSP 623 V+HPN+ + G ICLDILK+ W+ + +++ L+S+Q+LL P P Sbjct: 75 VYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDP 121 >UniRef50_UPI000049916F Cluster: ubiquitin-conjugating enzyme; n=1; Entamoeba histolytica HM-1:IMSS|Rep: ubiquitin-conjugating enzyme - Entamoeba histolytica HM-1:IMSS Length = 185 Score = 49.2 bits (112), Expect = 1e-04 Identities = 25/69 (36%), Positives = 40/69 (57%), Gaps = 2/69 (2%) Frame = +3 Query: 447 PIRTTCLSNL*LPVFHPNVDTCGLICLDILK-DK-WTALYDVRTVLLSIQSLLAEPNTQS 620 P + TC++ P++HPN+D G +CL L+ DK W+ + + V+ + SL EPN Sbjct: 91 PPKVTCVT----PIYHPNIDLEGHVCLSTLRLDKDWSPVSTLNHVVCGLLSLFLEPNPDD 146 Query: 621 PLNSSSFXT 647 PLN+ + T Sbjct: 147 PLNTEAGET 155 >UniRef50_Q586X5 Cluster: Ubiquitin carrier protein; n=3; Trypanosoma|Rep: Ubiquitin carrier protein - Trypanosoma brucei Length = 251 Score = 49.2 bits (112), Expect = 1e-04 Identities = 21/51 (41%), Positives = 31/51 (60%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 +FHPN+ G IC+++LK W +R VL ++ LL EPN +S LN + Sbjct: 77 IFHPNIAEKGDICVNVLKRDWNPSLGLRHVLTIVRCLLIEPNAESALNEEA 127 >UniRef50_A3FQP7 Cluster: Ubiquitin carrier protein; n=2; Cryptosporidium|Rep: Ubiquitin carrier protein - Cryptosporidium parvum Iowa II Length = 190 Score = 49.2 bits (112), Expect = 1e-04 Identities = 20/63 (31%), Positives = 34/63 (53%) Frame = +3 Query: 441 FIPIRTTCLSNL*LPVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQS 620 F P + CLS + HPN+D G +C++I+++ W + V+ + +LL EP+ Sbjct: 110 FKPPKVKCLSK----ILHPNIDKLGHVCINIIREDWKPTLTISIVICGLLNLLIEPSNSD 165 Query: 621 PLN 629 P N Sbjct: 166 PFN 168 >UniRef50_A2EP72 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 170 Score = 49.2 bits (112), Expect = 1e-04 Identities = 27/114 (23%), Positives = 51/114 (44%), Gaps = 13/114 (11%) Frame = +3 Query: 327 YQHSLXSENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVD 506 + L ++FKW T+ GP P + + P+FHPN+ Sbjct: 27 FSAGLIDNDVFKWRVTVFGPAGTPYEGGYYPAVLNFPDDYPNNPPTMKFI-CPMFHPNIK 85 Query: 507 TCGLICLDIL-------------KDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 G +C+ IL ++W ++ V ++++S+ S+L++PN +SP+N Sbjct: 86 NTGEVCISILHPPGKDQYEYEDKSERWLPIHTVESIIISVLSMLSDPNPESPMN 139 >UniRef50_Q0JLE6 Cluster: Ubiquitin carrier protein; n=4; Magnoliophyta|Rep: Ubiquitin carrier protein - Oryza sativa subsp. japonica (Rice) Length = 556 Score = 48.8 bits (111), Expect = 2e-04 Identities = 24/52 (46%), Positives = 31/52 (59%), Gaps = 4/52 (7%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDIL----KDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 P++HPN+D G ICLDIL K W ++ TVL SI LL++PN L Sbjct: 82 PIYHPNIDNGGRICLDILNLPPKGAWQPSLNIATVLTSIGLLLSDPNPDDGL 133 >UniRef50_Q4N5Y1 Cluster: Ubiquitin carrier protein; n=3; Piroplasmida|Rep: Ubiquitin carrier protein - Theileria parva Length = 157 Score = 48.8 bits (111), Expect = 2e-04 Identities = 26/96 (27%), Positives = 43/96 (44%), Gaps = 1/96 (1%) Frame = +3 Query: 345 SENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVD-TCGLI 521 + N+F W I GP PI+ + + FHPN++ G + Sbjct: 29 ASNIFNWTAYIRGPEGTPFESGIFKLLIHCPNSYPIQPPTV-HFATKCFHPNINFQTGEL 87 Query: 522 CLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 C+DILK W+ + ++ + + +L+ PN SPLN Sbjct: 88 CIDILKSNWSPAWTIQYLCRGVIYILSTPNPDSPLN 123 >UniRef50_A2G420 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 175 Score = 48.8 bits (111), Expect = 2e-04 Identities = 21/51 (41%), Positives = 29/51 (56%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 +FHPN+ G IC+ L WT + +LLSI+ LL +PN S LN + Sbjct: 79 IFHPNISDAGAICVSTLSSDWTEDMGLDHLLLSIKCLLLQPNPSSALNEEA 129 >UniRef50_A2EJF5 Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin-conjugating enzyme family protein - Trichomonas vaginalis G3 Length = 162 Score = 48.8 bits (111), Expect = 2e-04 Identities = 30/97 (30%), Positives = 43/97 (44%) Frame = +3 Query: 351 NLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICLD 530 +LF W I GP + PI ++ V H NV G +CL Sbjct: 40 DLFNWECLIPGPEKSLWEGGFYRLLLSFPTSYPINAP-IAKFDPIVPHVNVFPSGKVCLS 98 Query: 531 ILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSSF 641 IL D W ++R +L+ IQ LL EPN +SP + ++ Sbjct: 99 ILTDGWKPSINLRQILVGIQKLLIEPNPESPAHQVNY 135 >UniRef50_Q1DRT9 Cluster: Ubiquitin carrier protein; n=1; Coccidioides immitis|Rep: Ubiquitin carrier protein - Coccidioides immitis Length = 469 Score = 48.8 bits (111), Expect = 2e-04 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +3 Query: 486 VFHPNVD-TCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 ++HPNV+ + G +C+D LK W +R VL++I LL PN S LNS++ Sbjct: 87 IWHPNVEESTGAVCVDTLKRDWEPKLTLRDVLITISCLLIHPNPDSALNSAA 138 >UniRef50_Q8IH42 Cluster: Ubiquitin carrier protein; n=15; Fungi/Metazoa group|Rep: Ubiquitin carrier protein - Drosophila melanogaster (Fruit fly) Length = 180 Score = 48.4 bits (110), Expect = 3e-04 Identities = 31/118 (26%), Positives = 55/118 (46%), Gaps = 14/118 (11%) Frame = +3 Query: 318 IKEYQHSLXSEN-LFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFH 494 ++ + L S++ +FKW I GP K P+R + + ++H Sbjct: 34 VEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPPKMKFI-TEIWH 92 Query: 495 PNVDTCGLICLDIL-------------KDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 PN+D G +C+ IL +++W ++ V T+LLS+ S+L +PN +S N Sbjct: 93 PNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPNDESAAN 150 >UniRef50_Q24HQ3 Cluster: Ubiquitin carrier protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin carrier protein - Tetrahymena thermophila SB210 Length = 601 Score = 48.4 bits (110), Expect = 3e-04 Identities = 21/51 (41%), Positives = 30/51 (58%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSS 635 P++H NV++ G IC+DILKD W+ + V SI L+ PN L S+ Sbjct: 480 PIYHCNVNSQGRICIDILKDNWSPALTMAAVFNSISELMLHPNPIDALESN 530 >UniRef50_Q4WU34 Cluster: Ubiquitin carrier protein; n=16; Pezizomycotina|Rep: Ubiquitin carrier protein - Aspergillus fumigatus (Sartorya fumigata) Length = 272 Score = 48.4 bits (110), Expect = 3e-04 Identities = 21/47 (44%), Positives = 31/47 (65%), Gaps = 1/47 (2%) Frame = +3 Query: 486 VFHPNVDT-CGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSP 623 V+HPNV + G ICLD L W+ + +++ LLS+QSLL+ P + P Sbjct: 77 VWHPNVSSQTGAICLDTLSSAWSPVLTIKSALLSLQSLLSTPEPKDP 123 >UniRef50_A5DB66 Cluster: Ubiquitin carrier protein; n=1; Pichia guilliermondii|Rep: Ubiquitin carrier protein - Pichia guilliermondii (Yeast) (Candida guilliermondii) Length = 439 Score = 48.4 bits (110), Expect = 3e-04 Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 2/51 (3%) Frame = +3 Query: 483 PVFHPNVDT-CGLICLDILK-DKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 P+ HPNVD G ICLDILK + W+ + + V+++I L+ +P SPLN Sbjct: 82 PILHPNVDFGTGEICLDILKSESWSPAWTIEYVVVAILMLIDDPEPDSPLN 132 >UniRef50_P62253 Cluster: Ubiquitin-conjugating enzyme E2 G1; n=66; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 G1 - Homo sapiens (Human) Length = 170 Score = 48.4 bits (110), Expect = 3e-04 Identities = 31/118 (26%), Positives = 55/118 (46%), Gaps = 14/118 (11%) Frame = +3 Query: 318 IKEYQHSLXSEN-LFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFH 494 ++ + L +N L++W I GP K P+R + + ++H Sbjct: 22 VEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFI-TEIWH 80 Query: 495 PNVDTCGLICLDIL-------------KDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 PNVD G +C+ IL +++W ++ V T+++S+ S+LA+PN SP N Sbjct: 81 PNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPAN 138 >UniRef50_Q9AW53 Cluster: Ubiquitin carrier protein; n=1; Guillardia theta|Rep: Ubiquitin carrier protein - Guillardia theta (Cryptomonas phi) Length = 144 Score = 48.0 bits (109), Expect = 3e-04 Identities = 31/95 (32%), Positives = 45/95 (47%), Gaps = 1/95 (1%) Frame = +3 Query: 348 ENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNV-DTCGLIC 524 ++L+KW G I GP P+ ++ + +FHPNV + G IC Sbjct: 29 DDLYKWKGFIIGPNGTPYQGKSFNIECSVPLSYPLSPPKITFVD-QIFHPNVYPSNGEIC 87 Query: 525 LDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 LDILK++WT + + +I LL P SPLN Sbjct: 88 LDILKNQWTPAWTILFSCQAIIVLLTNPEPNSPLN 122 >UniRef50_Q7R2Z1 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 158 Score = 48.0 bits (109), Expect = 3e-04 Identities = 26/55 (47%), Positives = 33/55 (60%), Gaps = 2/55 (3%) Frame = +3 Query: 471 NL*LPVFHPNVDTC-GLICLDIL-KDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 N P+FHPNV G ICL+IL KD W+ + ++ SI L + PNT SPLN Sbjct: 73 NFTTPMFHPNVKFANGEICLNILTKDDWSPAISLISLAQSIAGLCSAPNTDSPLN 127 >UniRef50_Q5DI37 Cluster: Ubiquitin carrier protein; n=2; Schistosoma japonicum|Rep: Ubiquitin carrier protein - Schistosoma japonicum (Blood fluke) Length = 203 Score = 48.0 bits (109), Expect = 3e-04 Identities = 21/52 (40%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +3 Query: 486 VFHPNV-DTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 +FHPN+ G +C++ LK W + +R +LL+I+ LL EPN +S LN + Sbjct: 79 IFHPNIAPNTGEVCVNTLKKDWKSNLGLRHILLTIRCLLIEPNPESALNEEA 130 >UniRef50_Q9LJD7 Cluster: Constitutive photomorphogenesis protein 10; n=41; Eukaryota|Rep: Constitutive photomorphogenesis protein 10 - Arabidopsis thaliana (Mouse-ear cress) Length = 182 Score = 48.0 bits (109), Expect = 3e-04 Identities = 27/92 (29%), Positives = 42/92 (45%) Frame = +3 Query: 348 ENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICL 527 +NL+ WI TI GP P + L ++H NVDT G + + Sbjct: 63 DNLYHWIATIIGPSGTPYEGGIFFLDIIFPSDYPFKPPKLV-FKTRIYHCNVDTAGDLSV 121 Query: 528 DILKDKWTALYDVRTVLLSIQSLLAEPNTQSP 623 +IL+D W+ + VL +I+S+ +P SP Sbjct: 122 NILRDSWSPALTITKVLQAIRSIFLKPEPYSP 153 >UniRef50_UPI0000E4A01C Cluster: PREDICTED: similar to ENSANGP00000017916; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to ENSANGP00000017916 - Strongylocentrotus purpuratus Length = 206 Score = 47.6 bits (108), Expect = 5e-04 Identities = 20/35 (57%), Positives = 26/35 (74%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQ 590 +FHPNV G ICLDIL+++W+ YDV +L SIQ Sbjct: 159 MFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQ 193 >UniRef50_Q247Y5 Cluster: Ubiquitin carrier protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin carrier protein - Tetrahymena thermophila SB210 Length = 186 Score = 47.6 bits (108), Expect = 5e-04 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 ++HPN+D G +CL+IL+ W + ++ ++ + L EPN PLN + Sbjct: 103 IYHPNIDLQGNVCLNILRADWKPVLNLYNIISGVLFLFIEPNPNDPLNKQA 153 >UniRef50_Q6MYZ2 Cluster: Ubiquitin carrier protein; n=7; Trichocomaceae|Rep: Ubiquitin carrier protein - Aspergillus fumigatus (Sartorya fumigata) Length = 530 Score = 47.6 bits (108), Expect = 5e-04 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = +3 Query: 486 VFHPNVD-TCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 ++HPNV+ + G +C+D LK W + ++ VL++I LL PN S LNS++ Sbjct: 179 IWHPNVEESTGAVCVDTLKRDWKSTLTLKDVLVTISCLLIYPNPDSALNSTA 230 >UniRef50_Q0TZE7 Cluster: Ubiquitin carrier protein; n=1; Phaeosphaeria nodorum|Rep: Ubiquitin carrier protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 465 Score = 47.6 bits (108), Expect = 5e-04 Identities = 20/52 (38%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = +3 Query: 486 VFHPNVDTC-GLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 ++HPN+D G +C++ LK W++ +R VL++I LL +PN S LN ++ Sbjct: 117 LWHPNIDEATGAVCVETLKRDWSSALKLRDVLVTISCLLIQPNPASALNEAA 168 >UniRef50_Q8IJ70 Cluster: Ubiquitin carrier protein; n=9; Aconoidasida|Rep: Ubiquitin carrier protein - Plasmodium falciparum (isolate 3D7) Length = 191 Score = 47.2 bits (107), Expect = 6e-04 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +3 Query: 486 VFHPNVDTC-GLICLDILKDKWTALYDVRTVL-LSIQSLLAEPNTQSPLNSSS 638 + HPNVD G +CLD++ WT LY + V + + LL PN PLNS + Sbjct: 74 LLHPNVDEASGSVCLDVINQTWTPLYSLVNVFEVFLPQLLTYPNPSDPLNSDA 126 >UniRef50_A0BKX8 Cluster: Chromosome undetermined scaffold_113, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_113, whole genome shotgun sequence - Paramecium tetraurelia Length = 155 Score = 47.2 bits (107), Expect = 6e-04 Identities = 21/48 (43%), Positives = 31/48 (64%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 ++H NV+ G I L+ LK +W+ V+ +LL I SL +PN Q+PLN Sbjct: 74 IYHMNVNQQGCIALNTLKKEWSESIGVKKMLLEILSLFQKPNPQNPLN 121 >UniRef50_Q4P877 Cluster: Ubiquitin carrier protein; n=1; Ustilago maydis|Rep: Ubiquitin carrier protein - Ustilago maydis (Smut fungus) Length = 168 Score = 47.2 bits (107), Expect = 6e-04 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRT 572 ++HPN+D G ICLDILKDKW+ +RT Sbjct: 74 IYHPNIDKLGRICLDILKDKWSPALQIRT 102 >UniRef50_Q8LC61 Cluster: E2, ubiquitin-conjugating enzyme, putative; n=2; Arabidopsis thaliana|Rep: E2, ubiquitin-conjugating enzyme, putative - Arabidopsis thaliana (Mouse-ear cress) Length = 177 Score = 46.8 bits (106), Expect = 8e-04 Identities = 25/87 (28%), Positives = 41/87 (47%) Frame = +3 Query: 348 ENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICL 527 EN+F+W T++GP+ P ++ +FHPN+ G + Sbjct: 57 ENIFRWEATVSGPVGCPYEKGVFTVSVHIPPKYPYEPPKIT-FKTKIFHPNISEIGESFV 115 Query: 528 DILKDKWTALYDVRTVLLSIQSLLAEP 608 DIL +W++ + VLLSI S+L+ P Sbjct: 116 DILGSRWSSALTINLVLLSICSILSNP 142 >UniRef50_Q7QWW0 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 292 Score = 46.8 bits (106), Expect = 8e-04 Identities = 18/48 (37%), Positives = 33/48 (68%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 +FHPNV + G +CL++L+D + Y + ++L++I ++ EP + PLN Sbjct: 205 MFHPNVSSDGRVCLNLLRDDYEPSYTLVSLLMAILCVVEEPGLEHPLN 252 >UniRef50_A2EY78 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 144 Score = 46.8 bits (106), Expect = 8e-04 Identities = 20/47 (42%), Positives = 29/47 (61%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 ++HPN++ G ICLD LK++W Y ++ + I LL PN SPL Sbjct: 70 IYHPNINENGQICLDQLKNEWKPTYTLKHAIEFIIFLLQNPNWDSPL 116 >UniRef50_A2EGV7 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 175 Score = 46.8 bits (106), Expect = 8e-04 Identities = 21/62 (33%), Positives = 32/62 (51%) Frame = +3 Query: 453 RTTCLSNL*LPVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNS 632 R CL+ +FHPN+D G +CL IL++ + + ++ IQ L EP PLN Sbjct: 77 RVKCLTK----IFHPNIDEEGSVCLSILREAYNPTVSIPFLIAGIQYLFTEPEPNDPLNK 132 Query: 633 SS 638 + Sbjct: 133 EA 134 >UniRef50_Q9UTN8 Cluster: Ubiquitin conjugating enzyme Ubc14; n=1; Schizosaccharomyces pombe|Rep: Ubiquitin conjugating enzyme Ubc14 - Schizosaccharomyces pombe (Fission yeast) Length = 155 Score = 46.8 bits (106), Expect = 8e-04 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 1/107 (0%) Frame = +3 Query: 318 IKEYQHSLXSENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHP 497 I + + +L +NLF W T GP + P + + ++HP Sbjct: 24 IPDIRVNLVDDNLFHWACTALGPSDSVYAGGKFHFSLKFPLDYPFQPPTIEFT-TRIYHP 82 Query: 498 NVDTCGLICLDILKDK-WTALYDVRTVLLSIQSLLAEPNTQSPLNSS 635 N D+ G +CL ILK + + +R+VL I LL EPN PL +S Sbjct: 83 NFDSEGNVCLAILKQQVFKPSIKLRSVLEQILQLLREPNPDDPLVAS 129 Score = 35.5 bits (78), Expect = 1.9 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 394 TVYAGHKYKLSLEFPNSYPYAPPVCQIYDSLF 489 +VYAG K+ SL+FP YP+ PP + ++ Sbjct: 49 SVYAGGKFHFSLKFPLDYPFQPPTIEFTTRIY 80 >UniRef50_Q95017 Cluster: SUMO-conjugating enzyme UBC9; n=7; Eukaryota|Rep: SUMO-conjugating enzyme UBC9 - Caenorhabditis elegans Length = 166 Score = 46.8 bits (106), Expect = 8e-04 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDILKDK--WTALYDVRTVLLSIQSLLAEPNTQSPLNSSSF 641 P+FHPNV G +CL +L + W ++ +L+ IQ LL PN + P + ++ Sbjct: 80 PLFHPNVYPSGTVCLSLLDENKDWKPSISIKQLLIGIQDLLNHPNIEDPAQAEAY 134 >UniRef50_UPI00006CC8BE Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin-conjugating enzyme family protein - Tetrahymena thermophila SB210 Length = 147 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/52 (40%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDK-WTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 ++HPNV G +C ++L +K W V+TV+ I S+LAEPN S +N+ + Sbjct: 71 IWHPNVTDKGEVCKEMLGEKEWVPTKQVKTVIEIIASMLAEPNVDSAINNEA 122 >UniRef50_Q9VUR4 Cluster: Ubiquitin carrier protein; n=7; Eukaryota|Rep: Ubiquitin carrier protein - Drosophila melanogaster (Fruit fly) Length = 341 Score = 46.4 bits (105), Expect = 0.001 Identities = 35/110 (31%), Positives = 47/110 (42%), Gaps = 13/110 (11%) Frame = +3 Query: 339 LXSENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGL 518 + +NLF+W I GP P + L V+HPNV G Sbjct: 87 INDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPYSPPSIRFL-TKVWHPNVYENGD 145 Query: 519 ICLDILK-------------DKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 +C+ IL ++W +VRT+LLS+ SLL EPNT SP N Sbjct: 146 LCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPNTFSPAN 195 >UniRef50_Q753J8 Cluster: AFR314Wp; n=1; Eremothecium gossypii|Rep: AFR314Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii) Length = 155 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/50 (42%), Positives = 35/50 (70%), Gaps = 2/50 (4%) Frame = +3 Query: 486 VFHPNVD-TCGLICLDILK-DKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 + HPN+ + G +CLD+LK + W+ +Y++ V+ +I +LLAEP SPL+ Sbjct: 78 ICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLD 127 >UniRef50_Q5BE71 Cluster: Ubiquitin carrier protein; n=2; Trichocomaceae|Rep: Ubiquitin carrier protein - Emericella nidulans (Aspergillus nidulans) Length = 488 Score = 46.4 bits (105), Expect = 0.001 Identities = 20/52 (38%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = +3 Query: 486 VFHPNVD-TCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 ++HPNV+ + G +C+D LK W + ++ VL++I LL PN S LN+++ Sbjct: 118 IWHPNVEESTGAVCVDTLKRDWKSTLTLKDVLITISCLLIFPNPDSALNATA 169 >UniRef50_A7TP75 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 157 Score = 46.4 bits (105), Expect = 0.001 Identities = 29/99 (29%), Positives = 51/99 (51%), Gaps = 2/99 (2%) Frame = +3 Query: 339 LXSENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVD-TCG 515 + S++L W TI GP + P++ ++ + H N++ G Sbjct: 30 IDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTG 89 Query: 516 LICLDILKD-KWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 ICL+IL + W+ ++++ TV+L+I LL++P T SPLN Sbjct: 90 KICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLN 128 >UniRef50_Q54P16 Cluster: Ubiquitin conjugating enzyme; n=2; Dictyostelium discoideum|Rep: Ubiquitin conjugating enzyme - Dictyostelium discoideum AX4 Length = 148 Score = 46.0 bits (104), Expect = 0.001 Identities = 27/99 (27%), Positives = 44/99 (44%), Gaps = 1/99 (1%) Frame = +3 Query: 339 LXSENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTC-G 515 L +NL KW T+ GP + P + L ++HPN+ T G Sbjct: 26 LVDDNLQKWKATVQGPEGSPFEKGVFSMDIDIPADYPFKPPTLKFT-TKIYHPNIKTSDG 84 Query: 516 LICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNS 632 IC ++ W+ + VL +I+S+L +PN +PL + Sbjct: 85 AICAEVFST-WSPQLKILDVLTTIRSILTDPNPDNPLET 122 >UniRef50_Q4UI29 Cluster: Ubiquitin-conjugating enzyme E2 (RUB1 homologue), putative; n=2; Theileria|Rep: Ubiquitin-conjugating enzyme E2 (RUB1 homologue), putative - Theileria annulata Length = 249 Score = 46.0 bits (104), Expect = 0.001 Identities = 19/54 (35%), Positives = 34/54 (62%), Gaps = 6/54 (11%) Frame = +3 Query: 486 VFHPNV-----DTC-GLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 + HPN+ D C G +CL+IL++ W +Y + T ++ + +LL EP ++PL+ Sbjct: 171 IIHPNILGTNADKCKGAVCLNILREDWLPIYTIDTAIIGLVNLLIEPQFENPLD 224 >UniRef50_A7RTQ5 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 181 Score = 46.0 bits (104), Expect = 0.001 Identities = 33/104 (31%), Positives = 48/104 (46%), Gaps = 4/104 (3%) Frame = +3 Query: 339 LXSENLFKWIGTINGPLXNCXXXXXXXXXXXXSK-FIPIRTTCLSNL*LPVFHPNVD-TC 512 L ++LF W TI GP + F I + +P FHPNVD Sbjct: 9 LNDDDLFIWEATIKGPKDTLWEGGIFKLYLQFDEGFNDIPPKVYFHT-IP-FHPNVDPVT 66 Query: 513 GLICLDILKD--KWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 G+ CLD L D +W Y + +LLSIQ +L+ P + +N+ + Sbjct: 67 GIPCLDFLDDYDQWKEYYSLNYILLSIQMMLSNPVLKDAVNADA 110 >UniRef50_A7ARW5 Cluster: Putative uncharacterized protein; n=1; Babesia bovis|Rep: Putative uncharacterized protein - Babesia bovis Length = 423 Score = 46.0 bits (104), Expect = 0.001 Identities = 22/65 (33%), Positives = 37/65 (56%), Gaps = 2/65 (3%) Frame = +3 Query: 450 IRTTCLSNL*LP-VFHPNVDTC-GLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSP 623 +R CLS++ P + N C G +CL+I+++ W +Y V T L + +LL EP P Sbjct: 339 LRVKCLSSIRHPNILGANAPKCAGAVCLNIVREDWRPVYTVGTAALGLLNLLVEPQPIEP 398 Query: 624 LNSSS 638 L++ + Sbjct: 399 LDAEA 403 >UniRef50_A2DRC1 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 138 Score = 46.0 bits (104), Expect = 0.001 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 14/75 (18%) Frame = +3 Query: 447 PIRTTCLSNL*LPVFHPNVDTCGLICLDIL--------------KDKWTALYDVRTVLLS 584 P+R + L P+FHPN+ G +C+ IL +KW ++ + T+++S Sbjct: 33 PMRPPMMKFL-CPMFHPNIGEDGKVCISILHEQKDDPTNEQEQLNEKWLPVHTIETIVIS 91 Query: 585 IQSLLAEPNTQSPLN 629 + +L +PN QSPLN Sbjct: 92 VICMLGDPNPQSPLN 106 >UniRef50_A0EBF3 Cluster: Ubiquitin carrier protein; n=1; Paramecium tetraurelia|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 185 Score = 46.0 bits (104), Expect = 0.001 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAE-PNTQSPLNSSS 638 +FHPN+D G +CL+IL++ W + ++ V+ +Q L + N PLN + Sbjct: 101 IFHPNIDLEGKVCLNILREDWRPVSSLKDVIFGLQMLFTQLTNPTDPLNKEA 152 >UniRef50_Q1E8C5 Cluster: Ubiquitin carrier protein; n=9; Pezizomycotina|Rep: Ubiquitin carrier protein - Coccidioides immitis Length = 257 Score = 46.0 bits (104), Expect = 0.001 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Frame = +3 Query: 486 VFHPNVDTC-GLICLDILKDKWTALYDVRTVL-LSIQSLLAEPNTQSPLNSSS 638 ++HPN+D G +CLD++ W+ +YD+ + + + LL PN PLN + Sbjct: 144 IYHPNIDELSGSVCLDVINQTWSPMYDMINIFEVFLPQLLRYPNPSDPLNGDA 196 >UniRef50_Q9P6I1 Cluster: Ubiquitin-conjugating enzyme E2 16; n=1; Schizosaccharomyces pombe|Rep: Ubiquitin-conjugating enzyme E2 16 - Schizosaccharomyces pombe (Fission yeast) Length = 160 Score = 46.0 bits (104), Expect = 0.001 Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 1/94 (1%) Frame = +3 Query: 351 NLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVD-TCGLICL 527 ++F W I GP + PI + + HPN+ T G +C+ Sbjct: 33 DMFHWKAVIEGPTETPYEGGQWVLDIHVHEGYPISPPSVY-FQTKIVHPNISWTNGEVCM 91 Query: 528 DILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 DILK W+ + +++ L+I SLL+ + SPLN Sbjct: 92 DILKTHWSPAWSLQSACLAIISLLSNYDASSPLN 125 >UniRef50_Q8ILW5 Cluster: Ubiquitin conjugating enzyme, putative; n=7; Plasmodium|Rep: Ubiquitin conjugating enzyme, putative - Plasmodium falciparum (isolate 3D7) Length = 299 Score = 45.6 bits (103), Expect = 0.002 Identities = 29/94 (30%), Positives = 43/94 (45%) Frame = +3 Query: 321 KEYQHSLXSENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPN 500 KE L E+ KWI I G ++ PI + + L P HP+ Sbjct: 171 KENTIKLLQEHADKWIIQITGAENTLYSNETFQMQFKFTEKYPIESPEVIFLGQPPIHPH 230 Query: 501 VDTCGLICLDILKDKWTALYDVRTVLLSIQSLLA 602 + + G ICL IL D W+ + V ++ LSI S+L+ Sbjct: 231 IYSNGHICLSILYDHWSPVLSVNSICLSIISMLS 264 >UniRef50_Q4CQP3 Cluster: Ubiquitin carrier protein; n=4; Trypanosomatidae|Rep: Ubiquitin carrier protein - Trypanosoma cruzi Length = 238 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDK--WTALYDVRTVLLSIQSLLAEPNTQSPLNSSSF 641 +FHPNV G +CL IL ++ W ++ +LL+IQ LL PN + P + Sbjct: 158 LFHPNVYPSGTVCLSILNEEKDWRPSITIKQILLAIQELLDNPNIKDPAQEEPY 211 >UniRef50_P60604 Cluster: Ubiquitin-conjugating enzyme E2 G2; n=80; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 G2 - Homo sapiens (Human) Length = 165 Score = 45.6 bits (103), Expect = 0.002 Identities = 30/110 (27%), Positives = 46/110 (41%), Gaps = 13/110 (11%) Frame = +3 Query: 339 LXSENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGL 518 + EN F+W I GP C P+ + +FHPN+ G Sbjct: 29 MNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKM-RFTCEMFHPNIYPDGR 87 Query: 519 ICLDILK-------------DKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 +C+ IL ++W+ + V +LLS+ S+LAEPN +S N Sbjct: 88 VCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGAN 137 >UniRef50_UPI0000E487EE Cluster: PREDICTED: similar to ubiquitin conjugating enzyme, partial; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to ubiquitin conjugating enzyme, partial - Strongylocentrotus purpuratus Length = 162 Score = 45.2 bits (102), Expect = 0.002 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 13/61 (21%) Frame = +3 Query: 486 VFHPNVDTCGLICLDIL-------------KDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 ++HPN+D G +C+ IL ++W ++ V T+L+S+ S+LA+PN +SP Sbjct: 28 IWHPNIDKEGDVCISILHEPGEDKWGYERPSERWLPIHTVETILISVISMLADPNDESPA 87 Query: 627 N 629 N Sbjct: 88 N 88 >UniRef50_Q9FF66 Cluster: Ubiquitin carrier protein; n=8; Viridiplantae|Rep: Ubiquitin carrier protein - Arabidopsis thaliana (Mouse-ear cress) Length = 251 Score = 45.2 bits (102), Expect = 0.002 Identities = 21/51 (41%), Positives = 30/51 (58%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 +FHPNV + G IC++ LK W +R VL ++ LL EP +S LN + Sbjct: 82 IFHPNVASNGEICVNTLKKDWNPSLGLRHVLSVVRCLLIEPFPESALNEQA 132 >UniRef50_Q4Q5L3 Cluster: Ubiquitin carrier protein; n=6; Trypanosomatidae|Rep: Ubiquitin carrier protein - Leishmania major Length = 234 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = +3 Query: 486 VFHPNVDT-CGLICLDILKDKWTALYDVRTVL-LSIQSLLAEPNTQSPLN 629 + HPNVD G +CLD++ WT +Y + + + + LL PN PLN Sbjct: 76 ILHPNVDERSGSVCLDVINQTWTPMYQLENIFDVFLPQLLRYPNPSDPLN 125 >UniRef50_A0BIB5 Cluster: Chromosome undetermined scaffold_11, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_11, whole genome shotgun sequence - Paramecium tetraurelia Length = 204 Score = 45.2 bits (102), Expect = 0.002 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 2/39 (5%) Frame = +3 Query: 519 ICLDILKDKWTALYDVRTVLLSIQSLLA--EPNTQSPLN 629 ICLD+LKDKW+ +R++LL IQ LL+ P+ PLN Sbjct: 82 ICLDVLKDKWSPALQIRSILLQIQVLLSYTNPSMDDPLN 120 >UniRef50_Q6E683 Cluster: Ubiquitin carrier protein; n=1; Antonospora locustae|Rep: Ubiquitin carrier protein - Antonospora locustae (Nosema locustae) Length = 81 Score = 45.2 bits (102), Expect = 0.002 Identities = 16/51 (31%), Positives = 30/51 (58%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 +FHPN+D G +CL+ L+ W+ + ++ I L EP+ ++ LN+ + Sbjct: 10 IFHPNIDINGNVCLEFLRHNWSCAMGIEWIVWGIYLFLIEPSGENALNTEA 60 >UniRef50_A6RGW5 Cluster: Ubiquitin carrier protein; n=1; Ajellomyces capsulatus NAm1|Rep: Ubiquitin carrier protein - Ajellomyces capsulatus NAm1 Length = 198 Score = 45.2 bits (102), Expect = 0.002 Identities = 20/49 (40%), Positives = 28/49 (57%) Frame = +3 Query: 441 FIPIRTTCLSNL*LPVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSI 587 F P R C ++HPN+D G +CL+IL+D WTA DV+ V + Sbjct: 96 FEPPRVKCTQR----IYHPNIDPQGNVCLNILRDGWTAALDVQAVAFGL 140 >UniRef50_UPI00001628C0 Cluster: UBC7 (ubiquitin-conjugating enzyme 7); ubiquitin-protein ligase; n=1; Arabidopsis thaliana|Rep: UBC7 (ubiquitin-conjugating enzyme 7); ubiquitin-protein ligase - Arabidopsis thaliana Length = 198 Score = 44.8 bits (101), Expect = 0.003 Identities = 36/132 (27%), Positives = 60/132 (45%), Gaps = 14/132 (10%) Frame = +3 Query: 276 NDSRKS*WS*CGAVIKEYQH-SLXSENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPI 452 N+S+ S W+ + YQ+ S N+F+W TI GP + P Sbjct: 44 NNSKASPWN-----LSPYQNQSCDCYNIFEWSVTIIGPPDTLYEGGFFNAIMTFPQNYPN 98 Query: 453 RTTCLSNL*LPVFHPNVDTCGLICLDIL-------------KDKWTALYDVRTVLLSIQS 593 + ++HPNV + G +C+ IL ++WT ++ V +++LSI S Sbjct: 99 SPPTV-RFTSDMWHPNVYSDGRVCISILHPPGDDPSGYELASERWTPVHTVESIMLSIIS 157 Query: 594 LLAEPNTQSPLN 629 +L+ PN +SP N Sbjct: 158 MLSGPNDESPAN 169 >UniRef50_A6SKB5 Cluster: Putative uncharacterized protein; n=2; Sclerotiniaceae|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 153 Score = 44.8 bits (101), Expect = 0.003 Identities = 29/99 (29%), Positives = 45/99 (45%), Gaps = 3/99 (3%) Frame = +3 Query: 348 ENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNV--DTCGLI 521 E+L +W + GP K P + + N ++HPN+ D G I Sbjct: 29 EDLHQWKVEMEGPAETPYAGGLFVLNVVLPKDYPFKPPVV-NFVTRIYHPNITFDEKGSI 87 Query: 522 CLDILK-DKWTALYDVRTVLLSIQSLLAEPNTQSPLNSS 635 C+D LK DKW + +L +I++LL PN PL ++ Sbjct: 88 CVDELKQDKWKPSGKITAILGAIRNLLITPNPDDPLENT 126 >UniRef50_A3C6U5 Cluster: Ubiquitin carrier protein; n=2; Oryza sativa|Rep: Ubiquitin carrier protein - Oryza sativa subsp. japonica (Rice) Length = 191 Score = 44.4 bits (100), Expect = 0.004 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = +3 Query: 489 FHPNVDTCGLICLDILKDK--WTALYDVRTVLLSIQSLLAEPNTQSPLNSSSF 641 FHPNV G +CL IL + W V+ +L+ IQ LL +PN P + + Sbjct: 114 FHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGY 166 >UniRef50_A2E403 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 155 Score = 44.4 bits (100), Expect = 0.004 Identities = 17/51 (33%), Positives = 31/51 (60%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 ++HPN+D G ICL+I+K + + ++ I+ + PN SPLN+++ Sbjct: 79 IWHPNIDEEGNICLNIIKGDYNPTITILQIIQGIELIFVTPNPYSPLNNAA 129 >UniRef50_UPI0000D56950 Cluster: PREDICTED: similar to Ubiquitin-conjugating enzyme E2 T (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T); n=1; Tribolium castaneum|Rep: PREDICTED: similar to Ubiquitin-conjugating enzyme E2 T (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T) - Tribolium castaneum Length = 151 Score = 44.0 bits (99), Expect = 0.006 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 4/51 (7%) Frame = +3 Query: 486 VFHPNVDTCGLICLDIL----KDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 V+HPN+D G ICLD++ K W + +L++I+ LL PN + PL Sbjct: 73 VYHPNIDDNGRICLDLIKMPPKGNWRPTIGLEGLLIAIRMLLETPNPEDPL 123 >UniRef50_UPI0000499A56 Cluster: ubiquitin-conjugating enzyme; n=1; Entamoeba histolytica HM-1:IMSS|Rep: ubiquitin-conjugating enzyme - Entamoeba histolytica HM-1:IMSS Length = 160 Score = 44.0 bits (99), Expect = 0.006 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +3 Query: 489 FHPNVDTCGLICLDILKDK--WTALYDVRTVLLSIQSLLAEPNTQSP 623 FHPNV G ICL IL + W ++ +L+ +Q LL PN +SP Sbjct: 82 FHPNVFPNGQICLSILNESYDWKPTTSIKQILVGVQDLLDNPNKESP 128 >UniRef50_Q8SR07 Cluster: UBIQUITIN CONJUGATING ENZYME E2-20K; n=1; Encephalitozoon cuniculi|Rep: UBIQUITIN CONJUGATING ENZYME E2-20K - Encephalitozoon cuniculi Length = 151 Score = 44.0 bits (99), Expect = 0.006 Identities = 20/66 (30%), Positives = 36/66 (54%) Frame = +3 Query: 441 FIPIRTTCLSNL*LPVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQS 620 F P + CL N VFHPNVD G +C++IL+ W + + ++ +++ + E + Sbjct: 71 FKPPKLLCLDN----VFHPNVDDDGNVCMEILRLGWRPSHGLESIFVNLYVIFVEVTGED 126 Query: 621 PLNSSS 638 LN+ + Sbjct: 127 ALNTKA 132 >UniRef50_Q5YES5 Cluster: Ubiquitin conjugating enzyme E2 2; n=1; Bigelowiella natans|Rep: Ubiquitin conjugating enzyme E2 2 - Bigelowiella natans (Pedinomonas minutissima) (Chlorarachnion sp.(strain CCMP 621)) Length = 154 Score = 43.6 bits (98), Expect = 0.007 Identities = 17/49 (34%), Positives = 30/49 (61%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNS 632 ++HPN+D+ G IC LKD W++ + ++V+ I L+ P+ +NS Sbjct: 80 IYHPNIDSKGQICFQGLKDTWSSSMNAKSVIQFIIDLINNPDCGDAINS 128 >UniRef50_Q0JAS6 Cluster: Os04g0580400 protein; n=1; Oryza sativa (japonica cultivar-group)|Rep: Os04g0580400 protein - Oryza sativa subsp. japonica (Rice) Length = 139 Score = 43.6 bits (98), Expect = 0.007 Identities = 20/51 (39%), Positives = 26/51 (50%) Frame = +3 Query: 489 FHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSSF 641 FH NV G +CL IL W VR +L+ IQ L +PN S + S+ Sbjct: 50 FHINVYDSGAVCLSILSTAWKPSITVRQILIGIQELFDDPNPNSAAQNISY 100 >UniRef50_A2F4E2 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 150 Score = 43.6 bits (98), Expect = 0.007 Identities = 24/102 (23%), Positives = 47/102 (46%) Frame = +3 Query: 327 YQHSLXSENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVD 506 Y S+ +++ G I+GP + P+R ++ ++HPNV+ Sbjct: 23 YTFSVVGDDITHLRGIIHGPADSPYAGGNFTINISVPPEFPLRAPAVT-FGTKIYHPNVN 81 Query: 507 TCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNS 632 G ICL +LK++W+ + +L + L++ P+ LN+ Sbjct: 82 PEGNICLSLLKNEWSPKVKIMDILEQVYLLISAPDPIDALNT 123 >UniRef50_A0C227 Cluster: Chromosome undetermined scaffold_143, whole genome shotgun sequence; n=2; Oligohymenophorea|Rep: Chromosome undetermined scaffold_143, whole genome shotgun sequence - Paramecium tetraurelia Length = 148 Score = 43.6 bits (98), Expect = 0.007 Identities = 23/66 (34%), Positives = 39/66 (59%), Gaps = 1/66 (1%) Frame = +3 Query: 447 PIRTTCLSNL*LPVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQ-SP 623 PI + + L P H ++ + G ICL IL D+W+A ++V ++ LSIQS+++ + P Sbjct: 62 PIESPEVVFLGKPPEHEHIYSNGFICLSILYDEWSAAHNVSSLCLSIQSMMSSATIKMKP 121 Query: 624 LNSSSF 641 N + F Sbjct: 122 PNDADF 127 >UniRef50_Q8SSK3 Cluster: UBIQUITIN CONJUGATING ENZYME E2; n=1; Encephalitozoon cuniculi|Rep: UBIQUITIN CONJUGATING ENZYME E2 - Encephalitozoon cuniculi Length = 216 Score = 43.6 bits (98), Expect = 0.007 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 14/62 (22%) Frame = +3 Query: 486 VFHPNVDTCGLICLDIL--------------KDKWTALYDVRTVLLSIQSLLAEPNTQSP 623 +FHPN+ G +C+ IL KDKWT + ++RT+++SI +L PN SP Sbjct: 108 MFHPNIYEDGKMCISILEEDKQQDSSVFGDPKDKWTPVQNIRTIVMSIVVILNSPNISSP 167 Query: 624 LN 629 N Sbjct: 168 AN 169 >UniRef50_Q6BZP7 Cluster: Similarity; n=1; Yarrowia lipolytica|Rep: Similarity - Yarrowia lipolytica (Candida lipolytica) Length = 178 Score = 43.6 bits (98), Expect = 0.007 Identities = 19/40 (47%), Positives = 30/40 (75%) Frame = +3 Query: 480 LPVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLL 599 +P+ HP++ + G ICLDIL D+WT + V +V +S+QS+L Sbjct: 105 IPI-HPHIYSNGHICLDILGDEWTPVQTVASVCISLQSML 143 >UniRef50_Q5A339 Cluster: Ubiquitin carrier protein; n=2; Eukaryota|Rep: Ubiquitin carrier protein - Candida albicans (Yeast) Length = 219 Score = 43.6 bits (98), Expect = 0.007 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = +3 Query: 489 FHPNVDTCGLICLDILKDK--WTALYDVRTVLLSIQSLLAEPNTQSPLNSSSF 641 +HPNV G +CL IL + W + +LL +Q LL PN +SP ++ Sbjct: 142 YHPNVYPSGTVCLSILNESQDWKPAITLTQILLGVQELLDTPNKESPAQEDAY 194 >UniRef50_Q5VVX9 Cluster: Ubiquitin-conjugating enzyme E2 U; n=11; Eutheria|Rep: Ubiquitin-conjugating enzyme E2 U - Homo sapiens (Human) Length = 321 Score = 43.6 bits (98), Expect = 0.007 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 3/50 (6%) Frame = +3 Query: 489 FHPNVDT-CGLICLDILK--DKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 FHPNVD G C+D L +KW Y + ++LL++Q +L+ P ++P+N Sbjct: 77 FHPNVDPHTGQPCIDFLDNPEKWNTNYTLSSILLALQVMLSNPVLENPVN 126 >UniRef50_UPI0000F2B508 Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme E2C isoform 3; n=1; Monodelphis domestica|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme E2C isoform 3 - Monodelphis domestica Length = 153 Score = 43.2 bits (97), Expect = 0.010 Identities = 23/53 (43%), Positives = 33/53 (62%) Frame = +2 Query: 182 AQNINPHYASSSNPAKQSEDTIKLKDNHAVSKRLQKELMELMRCSDKGISAFP 340 +QN +P AS++ +++ + +V KRLQ+ELM LM DKGISAFP Sbjct: 3 SQNRDPAAASAAAASRKGAEPGAGAARGSVGKRLQQELMTLMMSGDKGISAFP 55 >UniRef50_Q0JI74 Cluster: Ubiquitin carrier protein; n=2; Oryza sativa (japonica cultivar-group)|Rep: Ubiquitin carrier protein - Oryza sativa subsp. japonica (Rice) Length = 368 Score = 43.2 bits (97), Expect = 0.010 Identities = 23/68 (33%), Positives = 34/68 (50%) Frame = +3 Query: 348 ENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICL 527 E++F W TI GP + P + +S VFHPN+++ G ICL Sbjct: 129 EDMFHWQATIMGPPDSPYAGGVFLVNIHFPPDYPFKPPKVS-FKTKVFHPNINSNGSICL 187 Query: 528 DILKDKWT 551 DILK++W+ Sbjct: 188 DILKEQWS 195 >UniRef50_A3AAT7 Cluster: Putative uncharacterized protein; n=4; Oryza sativa|Rep: Putative uncharacterized protein - Oryza sativa subsp. japonica (Rice) Length = 416 Score = 43.2 bits (97), Expect = 0.010 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 V+HPN+D G + LDI +D W+ + +LL S+L +P P N Sbjct: 277 VYHPNIDGKGRMALDIFQDNWSPALTINKLLLCFVSVLFDPLLDRPTN 324 >UniRef50_Q0IF72 Cluster: Ubiquitin-conjugating enzyme morgue; n=2; Culicidae|Rep: Ubiquitin-conjugating enzyme morgue - Aedes aegypti (Yellowfever mosquito) Length = 392 Score = 43.2 bits (97), Expect = 0.010 Identities = 18/44 (40%), Positives = 28/44 (63%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQ 617 + HPNV G + +DI++ W+ + +LLS+QSLL +P TQ Sbjct: 307 IVHPNVSRHGDVGIDIIQHNWSLALTISKLLLSVQSLLTDPFTQ 350 >UniRef50_Q6E689 Cluster: Ubiquitin carrier protein; n=1; Antonospora locustae|Rep: Ubiquitin carrier protein - Antonospora locustae (Nosema locustae) Length = 155 Score = 43.2 bits (97), Expect = 0.010 Identities = 17/27 (62%), Positives = 21/27 (77%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDV 566 VFHPNV G +CLDILK++W+ YDV Sbjct: 78 VFHPNVYASGDLCLDILKNRWSPTYDV 104 >UniRef50_UPI0000F2BBBB Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme E2U (putative),; n=1; Monodelphis domestica|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme E2U (putative), - Monodelphis domestica Length = 313 Score = 42.7 bits (96), Expect = 0.013 Identities = 29/98 (29%), Positives = 44/98 (44%), Gaps = 3/98 (3%) Frame = +3 Query: 345 SENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVD-TCGLI 521 S +L KW+ I G + S ++ +P FHPNVD T G Sbjct: 170 SNDLLKWVAEIKGQKKSIWEGCKFPLVMKFSPDYNYLPPAVAFNPVP-FHPNVDPTTGKP 228 Query: 522 CLDILKDK--WTALYDVRTVLLSIQSLLAEPNTQSPLN 629 +D L D W + ++++LLSIQ +L+ P P+N Sbjct: 229 SMDFLDDPNAWDRNHTLKSILLSIQEMLSYPTLHDPIN 266 >UniRef50_Q0TYP6 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 1587 Score = 42.7 bits (96), Expect = 0.013 Identities = 19/50 (38%), Positives = 28/50 (56%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNS 632 P++HPN++ G IC IL WT + +L +I SLL P P+N+ Sbjct: 1500 PIYHPNINRHGRICHSILDRNWTVDTSNKDLLDTIYSLLLVPEFSDPINT 1549 >UniRef50_A6R4R4 Cluster: Putative uncharacterized protein; n=2; Pezizomycotina|Rep: Putative uncharacterized protein - Ajellomyces capsulatus NAm1 Length = 193 Score = 42.7 bits (96), Expect = 0.013 Identities = 18/41 (43%), Positives = 30/41 (73%) Frame = +3 Query: 480 LPVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLA 602 +P+ HP++ + G+ICLD+L W+ + V +V +SIQS+LA Sbjct: 120 IPI-HPHIYSNGIICLDLLGSAWSPVQTVESVCMSIQSMLA 159 >UniRef50_P49428 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa; n=2; Pichia|Rep: Ubiquitin-conjugating enzyme E2-24 kDa - Pichia pastoris (Yeast) Length = 204 Score = 42.7 bits (96), Expect = 0.013 Identities = 21/47 (44%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = +3 Query: 492 HPNVD-TCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 HPN+ G ICLDIL+ KWT + + + L +I LL +P SPL+ Sbjct: 122 HPNIAFNTGEICLDILQAKWTPAWTLSSALTAIVLLLNDPEPLSPLD 168 >UniRef50_Q712K3 Cluster: Ubiquitin-conjugating enzyme E2 R2; n=61; Eumetazoa|Rep: Ubiquitin-conjugating enzyme E2 R2 - Homo sapiens (Human) Length = 238 Score = 42.7 bits (96), Expect = 0.013 Identities = 24/61 (39%), Positives = 34/61 (55%), Gaps = 13/61 (21%) Frame = +3 Query: 486 VFHPNVDTCGLICLDIL-------------KDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 ++HPN+ G +C+ IL ++W +VRT+LLS+ SLL EPNT SP Sbjct: 81 MWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPA 140 Query: 627 N 629 N Sbjct: 141 N 141 >UniRef50_Q6C713 Cluster: Similarities with DEHA0D15444g Debaryomyces hansenii; n=1; Yarrowia lipolytica|Rep: Similarities with DEHA0D15444g Debaryomyces hansenii - Yarrowia lipolytica (Candida lipolytica) Length = 153 Score = 42.3 bits (95), Expect = 0.017 Identities = 20/95 (21%), Positives = 43/95 (45%), Gaps = 1/95 (1%) Frame = +3 Query: 348 ENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVD-TCGLIC 524 ++L+KW + G + P++ + + HPN+ G +C Sbjct: 30 DSLYKWTAVMRGTEGTAYENGLWQVEINIPENYPLQPPTMF-FRTKICHPNIHFETGEVC 88 Query: 525 LDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 +D+LK +W+ + + + ++ ++L+ P SPLN Sbjct: 89 IDVLKTQWSPAWTISSACTAVSAMLSLPEPDSPLN 123 >UniRef50_A6RY09 Cluster: Putative uncharacterized protein; n=1; Botryotinia fuckeliana B05.10|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 167 Score = 42.3 bits (95), Expect = 0.017 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 2/50 (4%) Frame = +3 Query: 486 VFHPNVD-TCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQ-SPLN 629 + HPNV G ICLD+L DKWT + V L SI SL+A + SPLN Sbjct: 85 ICHPNVKWETGEICLDVLGDKWTPVLGVVGALESIASLVAGGGDETSPLN 134 >UniRef50_P29340 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa; n=3; Saccharomycetales|Rep: Ubiquitin-conjugating enzyme E2-21 kDa - Saccharomyces cerevisiae (Baker's yeast) Length = 183 Score = 42.3 bits (95), Expect = 0.017 Identities = 30/106 (28%), Positives = 49/106 (46%), Gaps = 2/106 (1%) Frame = +3 Query: 318 IKEYQHSLXSENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHP 497 I E + + +L KW I+GP P+ +S + + H Sbjct: 46 IIESLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHC 105 Query: 498 NVDTC-GLICLDILK-DKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 NV + G ICL+ILK ++WT ++D+ + ++ LL EP SPL+ Sbjct: 106 NVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLD 151 >UniRef50_Q7QQ94 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 164 Score = 41.9 bits (94), Expect = 0.022 Identities = 20/61 (32%), Positives = 36/61 (59%), Gaps = 13/61 (21%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILK-------------DKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 +FHPN+ + G +C+ IL ++W ++ V +++LS+ SLL++PN +SP Sbjct: 76 IFHPNIYSDGSVCISILHPPGPDPHQYETAAERWLPVHTVSSIILSVISLLSDPNCKSPA 135 Query: 627 N 629 N Sbjct: 136 N 136 >UniRef50_Q1EB54 Cluster: Ubiquitin-conjugating enzyme; n=7; Pezizomycotina|Rep: Ubiquitin-conjugating enzyme - Coccidioides immitis Length = 169 Score = 41.9 bits (94), Expect = 0.022 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 2/50 (4%) Frame = +3 Query: 486 VFHPNVD-TCGLICLDIL-KDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 + HPN+ + G ICL +L + W Y + + L +I LL++P +SPLN Sbjct: 79 ICHPNISFSTGEICLSLLTSEHWAPTYTLSSTLAAIHQLLSDPRPESPLN 128 >UniRef50_P42743 Cluster: Ubiquitin-conjugating enzyme E2-18 kDa; n=19; Spermatophyta|Rep: Ubiquitin-conjugating enzyme E2-18 kDa - Arabidopsis thaliana (Mouse-ear cress) Length = 161 Score = 41.9 bits (94), Expect = 0.022 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Frame = +3 Query: 492 HPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLL-AEPNTQSPLNSSSF 641 HP++ + G ICLDIL D W+ V +V +SI S+L + P Q P ++ + Sbjct: 89 HPHIYSNGHICLDILYDSWSPAMTVNSVCISILSMLSSSPAKQRPADNDRY 139 >UniRef50_A3LYJ5 Cluster: Predicted protein; n=3; Saccharomycetales|Rep: Predicted protein - Pichia stipitis (Yeast) Length = 182 Score = 41.5 bits (93), Expect = 0.030 Identities = 19/40 (47%), Positives = 29/40 (72%) Frame = +3 Query: 480 LPVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLL 599 +P+ HP+V + G ICL++L + WT + +VLLSIQS+L Sbjct: 109 IPI-HPHVYSNGHICLNLLGEDWTPACSIESVLLSIQSML 147 >UniRef50_UPI00015B43E7 Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme morgue; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme morgue - Nasonia vitripennis Length = 522 Score = 41.1 bits (92), Expect = 0.039 Identities = 24/85 (28%), Positives = 36/85 (42%) Frame = +3 Query: 363 WIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICLDILKD 542 W TI GP + P+R + L + HPNV G + +D + Sbjct: 401 WQATITGPAGSPYEGGVFYLYLQVPYSYPMRPPVVRFL-TKILHPNVSRHGDVGIDSIHH 459 Query: 543 KWTALYDVRTVLLSIQSLLAEPNTQ 617 W+ + VL+S+QSLL +P Q Sbjct: 460 NWSLALTISKVLISVQSLLTDPYCQ 484 >UniRef50_Q9VGD6 Cluster: CG14739-PA; n=2; Sophophora|Rep: CG14739-PA - Drosophila melanogaster (Fruit fly) Length = 206 Score = 40.7 bits (91), Expect = 0.052 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 2/50 (4%) Frame = +3 Query: 486 VFHPNVD-TCGLICLDILKDKWTALYDVRTVLLS-IQSLLAEPNTQSPLN 629 + HPN++ GL+C+++LK W++ YD+ + + + LL PN LN Sbjct: 81 ILHPNIEFITGLVCMNVLKQAWSSSYDLVNIFETFLPQLLRYPNPHDSLN 130 >UniRef50_UPI0000DBF7F5 Cluster: similar to ubiquitin-conjugating enzyme E2R 2 (LOC691764), mRNA; n=5; Amniota|Rep: similar to ubiquitin-conjugating enzyme E2R 2 (LOC691764), mRNA - Rattus norvegicus Length = 182 Score = 40.3 bits (90), Expect = 0.068 Identities = 25/63 (39%), Positives = 34/63 (53%) Frame = +3 Query: 441 FIPIRTTCLSNL*LPVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQS 620 FI C+S L LPV P ++ ++W +VRT++LS+ SLL EPNT S Sbjct: 30 FINNGDVCISILHLPVDDPQSG-------ELPSERWNPPQNVRTIVLSVISLLNEPNTFS 82 Query: 621 PLN 629 P N Sbjct: 83 PAN 85 >UniRef50_A2AX46 Cluster: Ubiquitin carrier protein; n=2; Eukaryota|Rep: Ubiquitin carrier protein - Guillardia theta (Cryptomonas phi) Length = 201 Score = 40.3 bits (90), Expect = 0.068 Identities = 28/107 (26%), Positives = 50/107 (46%), Gaps = 14/107 (13%) Frame = +3 Query: 351 NLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICLD 530 N+ +W I+GP + + P + + L P++HPNV + G +C+ Sbjct: 68 NMLEWNICISGPPDSLYEGGIFSARLSFPENYPDKPPSMKFL-TPIWHPNVYSNGDVCIS 126 Query: 531 IL----KD----------KWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 IL +D +W ++ V T++LS+ S+L++P SP N Sbjct: 127 ILHAPGEDATNPQELASMRWNPVHTVETIVLSVISMLSDPTDDSPAN 173 >UniRef50_Q9Y165 Cluster: CG15437-PA; n=4; Sophophora|Rep: CG15437-PA - Drosophila melanogaster (Fruit fly) Length = 491 Score = 40.3 bits (90), Expect = 0.068 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKD-KWTALYDVRTVLLSIQSLLAEPNTQ 617 + HPNV G + +DI + W+ +V VLLS+QSLL +P T+ Sbjct: 409 ILHPNVSRHGDVGIDIFQQHNWSLALNVAKVLLSVQSLLTDPYTE 453 >UniRef50_A0D4V6 Cluster: Chromosome undetermined scaffold_38, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_38, whole genome shotgun sequence - Paramecium tetraurelia Length = 149 Score = 40.3 bits (90), Expect = 0.068 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +3 Query: 486 VFHPNVDTCGLICLDIL--KDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 +FHPN+ G C D++ KD+W V+ VL I +++ + NT+ LN + Sbjct: 73 IFHPNITEKGEFCEDMIETKDQWQPTKTVKQVLEKILNIMGQVNTEQALNQKA 125 Score = 33.5 bits (73), Expect = 7.9 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 394 TVYAGHKYKLSLEFPNSYPYAPP 462 T Y G K+KLS+ FP +YP+ P Sbjct: 43 TAYQGGKFKLSITFPENYPFKAP 65 >UniRef50_Q5BAL7 Cluster: Putative uncharacterized protein; n=3; Pezizomycotina|Rep: Putative uncharacterized protein - Emericella nidulans (Aspergillus nidulans) Length = 185 Score = 40.3 bits (90), Expect = 0.068 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 2/56 (3%) Frame = +3 Query: 480 LPVFHPNVDTCGLICLDILKDK-WTALYDVRTVLLSIQSLL-AEPNTQSPLNSSSF 641 +P+ HP++ + G+ICLD+L W+ + V +V +SIQS+L A + P S F Sbjct: 111 IPI-HPHIYSNGIICLDLLSSAGWSPVQTVESVCMSIQSMLTANTRNERPPGDSEF 165 >UniRef50_UPI0000498417 Cluster: ubiquitin-conjugating enzyme; n=1; Entamoeba histolytica HM-1:IMSS|Rep: ubiquitin-conjugating enzyme - Entamoeba histolytica HM-1:IMSS Length = 219 Score = 39.9 bits (89), Expect = 0.090 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 13/63 (20%) Frame = +3 Query: 489 FHPNVDTCGLICLDIL-------------KDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 +HPNV G +C+ IL ++W V ++LLS+QS+L +PN SP N Sbjct: 76 WHPNVYPDGKVCISILHPPGEDEMSGELASERWLPTQSVSSILLSVQSMLCDPNMYSPAN 135 Query: 630 SSS 638 + + Sbjct: 136 TDA 138 >UniRef50_Q0UIW0 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 159 Score = 39.9 bits (89), Expect = 0.090 Identities = 28/99 (28%), Positives = 43/99 (43%), Gaps = 3/99 (3%) Frame = +3 Query: 348 ENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNV--DTCGLI 521 +N+ KW ++GP + P + +S ++HPNV D G + Sbjct: 37 QNITKWECVMDGPEQSIYAGGHFKLEINFPNEYPFKPPVVS-FRTKIYHPNVTNDDKGSM 95 Query: 522 CLDILK-DKWTALYDVRTVLLSIQSLLAEPNTQSPLNSS 635 CL +L+ + W V VL IQ+LL EPN + S Sbjct: 96 CLGLLRPESWKPPNKVVAVLRLIQTLLIEPNVDDAIEPS 134 Score = 38.7 bits (86), Expect = 0.21 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 394 TVYAGHKYKLSLEFPNSYPYAPPVCQIYDSLF 489 ++YAG +KL + FPN YP+ PPV ++ Sbjct: 52 SIYAGGHFKLEINFPNEYPFKPPVVSFRTKIY 83 >UniRef50_A1DHS5 Cluster: Ubiquitin conjugating enzyme, putative; n=11; Pezizomycotina|Rep: Ubiquitin conjugating enzyme, putative - Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / NRRL 181)(Aspergillus fischerianus (strain ATCC 1020 / DSM 3700 / NRRL 181)) Length = 179 Score = 39.9 bits (89), Expect = 0.090 Identities = 23/70 (32%), Positives = 41/70 (58%), Gaps = 2/70 (2%) Frame = +3 Query: 438 KFIPIRTTCLSNL*LPVFHPNVDTCGLICLDILKDK-WTALYDVRTVLLSIQSLLAEPN- 611 +FI + +T + +P+ HP++ + G+ICLD+L W+ + V +V +SIQS+L N Sbjct: 91 QFIELPSTSDTPRPIPM-HPHIYSNGIICLDLLSSAGWSPVQTVESVCMSIQSMLTANNR 149 Query: 612 TQSPLNSSSF 641 + P + F Sbjct: 150 NERPPGDAEF 159 >UniRef50_Q4U8F2 Cluster: Ubiquitin carrier protein; n=2; Piroplasmida|Rep: Ubiquitin carrier protein - Theileria annulata Length = 170 Score = 39.5 bits (88), Expect = 0.12 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 14/62 (22%) Frame = +3 Query: 486 VFHPNVDTCGLICLDIL--------------KDKWTALYDVRTVLLSIQSLLAEPNTQSP 623 ++HPN+ G +C+ IL ++W + V T+L+S+ S+L EPN +SP Sbjct: 82 MWHPNIYPDGRVCISILHPPGSDRYNEQELPNERWRPILGVETILISVISMLGEPNLESP 141 Query: 624 LN 629 N Sbjct: 142 AN 143 >UniRef50_A0CD76 Cluster: Ubiquitin carrier protein; n=4; Paramecium tetraurelia|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 232 Score = 39.5 bits (88), Expect = 0.12 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTAL-YDVRTVLLSIQSLLAEPNTQSPLNSSS 638 +FHPNV G IC++ LK W L + ++ + I+ LL P +S LN + Sbjct: 115 IFHPNVSEKGEICVNTLKKDWNPLQWSLKNIFEVIKCLLIVPFPESSLNEEA 166 >UniRef50_A7TL65 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 323 Score = 39.5 bits (88), Expect = 0.12 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 12/60 (20%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILK------------DKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 ++HPNV G +C+ IL + W+ + V +VL+SI SLL +PN SP N Sbjct: 83 IYHPNVYRDGRLCISILHQSGDPMTDELDAETWSPVQTVESVLISIVSLLEDPNISSPAN 142 >UniRef50_P27949 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa; n=2; African swine fever virus|Rep: Ubiquitin-conjugating enzyme E2-21 kDa - African swine fever virus (strain BA71V) (ASFV) Length = 215 Score = 39.5 bits (88), Expect = 0.12 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 8/56 (14%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDK--------WTALYDVRTVLLSIQSLLAEPNTQSPLN 629 ++HPN+ G +C+ IL W+ + T+LLS+ SLL EPN SP N Sbjct: 73 MWHPNIYPDGRLCISILHGDNAEEQGMTWSPAQKIDTILLSVISLLNEPNPDSPAN 128 >UniRef50_P14682 Cluster: Ubiquitin-conjugating enzyme E2-34 kDa; n=14; Ascomycota|Rep: Ubiquitin-conjugating enzyme E2-34 kDa - Saccharomyces cerevisiae (Baker's yeast) Length = 295 Score = 39.5 bits (88), Expect = 0.12 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 12/60 (20%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILK------------DKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 ++HPNV G +C+ IL + W+ + V +VL+SI SLL +PN SP N Sbjct: 83 IYHPNVYRDGRLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNINSPAN 142 >UniRef50_UPI0000D57489 Cluster: PREDICTED: similar to CG15437-PA; n=1; Tribolium castaneum|Rep: PREDICTED: similar to CG15437-PA - Tribolium castaneum Length = 392 Score = 39.1 bits (87), Expect = 0.16 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEP 608 +FHPNV G I +D + W+ + +L+SIQSLL +P Sbjct: 312 IFHPNVSRHGDIGIDSIHHNWSLALTLSKLLISIQSLLTDP 352 >UniRef50_UPI0000519DF4 Cluster: PREDICTED: similar to modifier of rpr and grim, ubiquitously expressed CG15437-PA, partial; n=1; Apis mellifera|Rep: PREDICTED: similar to modifier of rpr and grim, ubiquitously expressed CG15437-PA, partial - Apis mellifera Length = 481 Score = 39.1 bits (87), Expect = 0.16 Identities = 23/85 (27%), Positives = 36/85 (42%) Frame = +3 Query: 363 WIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICLDILKD 542 W TI GP+ + P+ + L + HPNV G + +D + Sbjct: 360 WQATITGPVGSPYEGGLFYLYLQVPCSYPLYPPIVRFL-TKILHPNVSRHGDVGIDSIHH 418 Query: 543 KWTALYDVRTVLLSIQSLLAEPNTQ 617 W+ + VL+S+QSLL +P Q Sbjct: 419 NWSLALTISKVLISVQSLLTDPYCQ 443 >UniRef50_Q5DD88 Cluster: Ubiquitin carrier protein; n=2; Schistosoma japonicum|Rep: Ubiquitin carrier protein - Schistosoma japonicum (Blood fluke) Length = 289 Score = 39.1 bits (87), Expect = 0.16 Identities = 30/104 (28%), Positives = 42/104 (40%), Gaps = 13/104 (12%) Frame = +3 Query: 348 ENLFKWIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICL 527 ENLF W I GP P + + ++HPN+ G +C+ Sbjct: 37 ENLFVWDVAIFGPPMTLYEGGYFKARLCFPDDYPYSPPTMHFM-SRMYHPNIYENGEVCI 95 Query: 528 DIL-------------KDKWTALYDVRTVLLSIQSLLAEPNTQS 620 IL ++W +VRT+LLS+ SLL EPN S Sbjct: 96 SILHSPGDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNVHS 139 >UniRef50_Q9BQP0 Cluster: Ubiquitin-conjugating enzyme E2C; n=4; Catarrhini|Rep: Ubiquitin-conjugating enzyme E2C - Homo sapiens (Human) Length = 161 Score = 39.1 bits (87), Expect = 0.16 Identities = 24/53 (45%), Positives = 31/53 (58%) Frame = +2 Query: 182 AQNINPHYASSSNPAKQSEDTIKLKDNHAVSKRLQKELMELMRCSDKGISAFP 340 +QN +P A+S A++ + V KRLQ+ELM LM DKGISAFP Sbjct: 3 SQNRDPA-ATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFP 54 >UniRef50_A2ADC1 Cluster: Novel protein containing an Ubiquitin-conjugating enzyme domain; n=4; Eutheria|Rep: Novel protein containing an Ubiquitin-conjugating enzyme domain - Mus musculus (Mouse) Length = 352 Score = 38.7 bits (86), Expect = 0.21 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 3/50 (6%) Frame = +3 Query: 489 FHPNVDT-CGLICLDILKD--KWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 FHPNVD G +D L KW Y V ++LL +Q LL+ P ++P+N Sbjct: 77 FHPNVDPYTGKPSIDFLDKPGKWNTNYTVLSILLDLQMLLSYPVLKNPVN 126 >UniRef50_Q20617 Cluster: Putative uncharacterized protein ubc-24; n=2; Caenorhabditis|Rep: Putative uncharacterized protein ubc-24 - Caenorhabditis elegans Length = 160 Score = 38.7 bits (86), Expect = 0.21 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Frame = +3 Query: 486 VFHPNVD--TCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 V+HPNVD TC L +L++ W + VLL++ LL EP+ P+N Sbjct: 85 VYHPNVDPVTCELCSPMLLQENWKPETTMEDVLLNLIVLLNEPDLSRPVN 134 >UniRef50_A2DSA6 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 203 Score = 38.7 bits (86), Expect = 0.21 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Frame = +3 Query: 441 FIPIRTTCLSNL*LPVFHPNVDTCGLICLDILK-DKWTALYDVRTVLLSIQSLLAEPNTQ 617 +IP + CL+ ++HPN+D G +CL L+ + + A + +++ LL PN Sbjct: 92 YIPPKVLCLTK----IWHPNIDEDGNVCLSTLRGETYLASTSIHAHYVALGFLLKNPNPS 147 Query: 618 SPLNSS 635 PL+++ Sbjct: 148 DPLDAN 153 >UniRef50_Q4P8X0 Cluster: Putative uncharacterized protein; n=1; Ustilago maydis|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 152 Score = 38.7 bits (86), Expect = 0.21 Identities = 18/51 (35%), Positives = 33/51 (64%), Gaps = 1/51 (1%) Frame = +3 Query: 492 HPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAE-PNTQSPLNSSSF 641 HP+V + G IC IL ++W+ + + +VLL++QS+LA Q P ++ ++ Sbjct: 82 HPHVYSNGHICASILGNEWSPVLTISSVLLTLQSMLASCKQLQRPPDNDAY 132 >UniRef50_A7EC39 Cluster: Putative uncharacterized protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 169 Score = 38.7 bits (86), Expect = 0.21 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Frame = +3 Query: 486 VFHPNVD-TCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQ-SPLN 629 + HPNV G ICLD+L DKWT + V L + +L+A + SPLN Sbjct: 85 ICHPNVKWETGEICLDVLADKWTPVLGVVGALECVGALVAGGGDETSPLN 134 >UniRef50_UPI00006064E0 Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme E2D 4 (putative); n=1; Mus musculus|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme E2D 4 (putative) - Mus musculus Length = 85 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAE 605 ++HPN+++ G ICLDIL+ +W+ V LL + + E Sbjct: 36 IYHPNINSNGSICLDILRSQWSPALTVSKGLLCLALAILE 75 >UniRef50_Q28XJ5 Cluster: GA20189-PA; n=1; Drosophila pseudoobscura|Rep: GA20189-PA - Drosophila pseudoobscura (Fruit fly) Length = 240 Score = 38.3 bits (85), Expect = 0.28 Identities = 19/41 (46%), Positives = 28/41 (68%) Frame = +3 Query: 480 LPVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLA 602 +PV HP+V + G ICL IL + W+ V++V LSI S+L+ Sbjct: 120 IPV-HPHVYSNGHICLSILTEDWSPALSVQSVCLSIASMLS 159 >UniRef50_A7STQ7 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 130 Score = 38.3 bits (85), Expect = 0.28 Identities = 16/49 (32%), Positives = 28/49 (57%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNS 632 ++HPN+D +C+ +L D W A D+ ++ + L PN + PL+S Sbjct: 44 IYHPNMDGYDGVCMSLLDD-WQASNDLEDLVQGLLFLFYNPNLEDPLSS 91 >UniRef50_Q8SS54 Cluster: Ubiquitin carrier protein; n=1; Encephalitozoon cuniculi|Rep: Ubiquitin carrier protein - Encephalitozoon cuniculi Length = 172 Score = 38.3 bits (85), Expect = 0.28 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 13/61 (21%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILK-------------DKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 ++HPN+D G +C+ IL D+W + +V+LSI +LL PN +SP Sbjct: 79 MWHPNIDENGNVCISILHNPGEDEYGYESLGDRWLPVRTPESVILSIITLLTSPNCESPA 138 Query: 627 N 629 N Sbjct: 139 N 139 >UniRef50_Q2H4J3 Cluster: Putative uncharacterized protein; n=2; Fungi/Metazoa group|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 113 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +3 Query: 534 LKDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 + D W+ +RT+LLSIQ+LL PN PL Sbjct: 53 IPDNWSPALQIRTILLSIQALLGAPNPDDPL 83 >UniRef50_A5DNI5 Cluster: Putative uncharacterized protein; n=1; Pichia guilliermondii|Rep: Putative uncharacterized protein - Pichia guilliermondii (Yeast) (Candida guilliermondii) Length = 155 Score = 37.9 bits (84), Expect = 0.36 Identities = 17/47 (36%), Positives = 29/47 (61%) Frame = +3 Query: 480 LPVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQS 620 +P+ HP++ + G ICL++L + WT + ++LLSI S+L S Sbjct: 82 IPI-HPHIYSNGHICLNLLGEDWTPACLIESILLSIHSMLVHNTNNS 127 >UniRef50_O14933 Cluster: Ubiquitin/ISG15-conjugating enzyme E2 L6; n=4; Homo/Pan/Gorilla group|Rep: Ubiquitin/ISG15-conjugating enzyme E2 L6 - Homo sapiens (Human) Length = 152 Score = 37.9 bits (84), Expect = 0.36 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +3 Query: 486 VFHPNVDTCGLICLDIL-KDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 ++HPNVD G ICL I+ + W VL ++ L+ PN + PL Sbjct: 73 IYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPL 120 >UniRef50_A2EFK5 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 160 Score = 37.5 bits (83), Expect = 0.48 Identities = 18/59 (30%), Positives = 32/59 (54%) Frame = +3 Query: 453 RTTCLSNL*LPVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 RTT L+ +FHPN+DT G IC++ ++ + + ++ ++ L +PN LN Sbjct: 73 RTTMLTK----IFHPNIDTDGTICINAIRGGYFPGQSLVQIIEEVKMALKDPNPDDYLN 127 >UniRef50_Q96B02 Cluster: Probable ubiquitin-conjugating enzyme E2 W; n=50; Eukaryota|Rep: Probable ubiquitin-conjugating enzyme E2 W - Homo sapiens (Human) Length = 151 Score = 37.5 bits (83), Expect = 0.48 Identities = 19/41 (46%), Positives = 28/41 (68%) Frame = +3 Query: 480 LPVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLA 602 +PV HP+V + G ICL IL + W+ V++V LSI S+L+ Sbjct: 78 IPV-HPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLS 117 >UniRef50_Q54J27 Cluster: Ubiquitin carrier protein; n=6; Eukaryota|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 517 Score = 37.1 bits (82), Expect = 0.64 Identities = 15/50 (30%), Positives = 30/50 (60%) Frame = +3 Query: 480 LPVFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 + + HP D ++ ++ +++W V T++LS+ S+L++PN SP N Sbjct: 109 ISILHPPGDD--ILSGELPEERWLPTQSVTTIILSLMSILSDPNCSSPAN 156 >UniRef50_Q20872 Cluster: Ubiquitin e2 (Conjugating enzyme) variant protein 2; n=1; Caenorhabditis elegans|Rep: Ubiquitin e2 (Conjugating enzyme) variant protein 2 - Caenorhabditis elegans Length = 230 Score = 37.1 bits (82), Expect = 0.64 Identities = 26/90 (28%), Positives = 40/90 (44%), Gaps = 1/90 (1%) Frame = +3 Query: 363 WIGTINGPLXNCXXXXXXXXXXXXSKFIPIRTTCLSNL*LPVFHPNVDTCGLICLDIL-K 539 WI T+ GP + K+ I C P+ HPNVD G I L +L + Sbjct: 71 WICTVPGPRGSPWEGGEYEVSVNFHKWPIIPPIC--EFKTPLHHPNVDLRGSIYLKMLEQ 128 Query: 540 DKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 + W++ ++ +L I +LLA P+ N Sbjct: 129 EHWSSETSLKKLLREISNLLATPDLTQAAN 158 >UniRef50_A0C867 Cluster: Ubiquitin carrier protein; n=4; Oligohymenophorea|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 233 Score = 37.1 bits (82), Expect = 0.64 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 12/60 (20%) Frame = +3 Query: 486 VFHPNVDTCGLICLDIL------------KDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 ++HPN+ + G +C+ IL + +W + VL+SI S+L+EPN SP N Sbjct: 145 MWHPNIYSDGRVCISILHAQDEFNDQEPPETRWRPILTPEDVLISIVSMLSEPNINSPAN 204 >UniRef50_P68036 Cluster: Ubiquitin-conjugating enzyme E2 L3; n=66; Eumetazoa|Rep: Ubiquitin-conjugating enzyme E2 L3 - Homo sapiens (Human) Length = 154 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/50 (28%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILK-DKWTALYDVRTVLLSIQSLLAEPNTQSPLNS 632 ++HPN+D G +CL ++ + W V+ S+ +L+ +P + PL + Sbjct: 74 IYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRA 123 >UniRef50_Q4N4K0 Cluster: Ubiquitin-protein ligase, putative; n=3; Theileria|Rep: Ubiquitin-protein ligase, putative - Theileria parva Length = 309 Score = 36.3 bits (80), Expect = 1.1 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +1 Query: 394 TVYAGHKYKLSLEFPNSYPYAPPV 465 T+YAG +YK+ + PN YP PP+ Sbjct: 79 TIYAGEEYKIKVILPNGYPLKPPI 102 >UniRef50_A2EHL8 Cluster: Ubiquitin-conjugating enzyme family protein; n=3; Trichomonas vaginalis G3|Rep: Ubiquitin-conjugating enzyme family protein - Trichomonas vaginalis G3 Length = 967 Score = 36.3 bits (80), Expect = 1.1 Identities = 17/50 (34%), Positives = 29/50 (58%) Frame = +3 Query: 492 HPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLNSSSF 641 HPN+ G I +D+L+ + + + LL+I++LL++PN S N F Sbjct: 793 HPNITIDGSINIDVLRSRHNSNVTIYFALLAIRNLLSKPNFDSIQNMEVF 842 >UniRef50_Q9QZU9 Cluster: Ubiquitin/ISG15-conjugating enzyme E2 L6; n=12; Mammalia|Rep: Ubiquitin/ISG15-conjugating enzyme E2 L6 - Mus musculus (Mouse) Length = 152 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = +3 Query: 486 VFHPNVDTCGLICLDIL-KDKWTALYDVRTVLLSIQSLLAEPNTQSPL 626 ++HPNV GL+CL ++ + W VL ++ L+++PN + P+ Sbjct: 73 IYHPNVREDGLVCLPLISNENWKPYTKPYQVLEALNVLVSKPNLEEPV 120 >UniRef50_UPI000066142F Cluster: Homolog of Brachydanio rerio "Ubiquitin-conjugating enzyme E2D 2.; n=1; Takifugu rubripes|Rep: Homolog of Brachydanio rerio "Ubiquitin-conjugating enzyme E2D 2. - Takifugu rubripes Length = 156 Score = 35.9 bits (79), Expect = 1.5 Identities = 11/22 (50%), Positives = 19/22 (86%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWT 551 ++HPN+++ G ICLDIL+ +W+ Sbjct: 44 IYHPNINSNGSICLDILRSQWS 65 >UniRef50_Q96JB9 Cluster: Ubiquitin UBF-fl; n=1; Homo sapiens|Rep: Ubiquitin UBF-fl - Homo sapiens (Human) Length = 89 Score = 35.9 bits (79), Expect = 1.5 Identities = 23/55 (41%), Positives = 31/55 (56%) Frame = +2 Query: 176 IMAQNINPHYASSSNPAKQSEDTIKLKDNHAVSKRLQKELMELMRCSDKGISAFP 340 I +QN +P S + K +E + V+KRLQ+ELM LM DK ISA+P Sbjct: 17 IASQNFDPATVSVATAHKGAEPSRGTAWG-PVAKRLQQELMTLMMPGDKRISAYP 70 >UniRef50_Q4Q5I6 Cluster: Ubiquitin carrier protein; n=5; Trypanosomatidae|Rep: Ubiquitin carrier protein - Leishmania major Length = 271 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 394 TVYAGHKYKLSLEFPNSYPYAPPVCQIYDSLF 489 T YAG +YK SL FP +P PP ++ S + Sbjct: 44 TPYAGGQYKASLTFPKEFPMEPPTFRVISSFW 75 >UniRef50_A0DRM5 Cluster: Chromosome undetermined scaffold_60, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_60, whole genome shotgun sequence - Paramecium tetraurelia Length = 191 Score = 35.1 bits (77), Expect = 2.6 Identities = 12/48 (25%), Positives = 26/48 (54%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWTALYDVRTVLLSIQSLLAEPNTQSPLN 629 + H N+ GL+C+ ++ + W + V+++I+ + PN + P N Sbjct: 118 IIHENIYGDGLLCMPMVTNNWKGNEGLTQVMMTIRDIFNNPNDKDPAN 165 >UniRef50_Q2U429 Cluster: Ubiquitin carrier protein; n=7; Pezizomycotina|Rep: Ubiquitin carrier protein - Aspergillus oryzae Length = 226 Score = 35.1 bits (77), Expect = 2.6 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 13/62 (20%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDIL-------------KDKWTALYDVRTVLLSIQSLLAEPNTQSP 623 P++HPN+ G +C+ IL ++W+ V +VL+SI SLL + SP Sbjct: 71 PLYHPNIYPDGKLCISILHAPGEDEMSGELASERWSPAQRVESVLISILSLLDDAEVSSP 130 Query: 624 LN 629 N Sbjct: 131 AN 132 >UniRef50_Q4T6K8 Cluster: Chromosome undetermined SCAF8718, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome undetermined SCAF8718, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 782 Score = 34.7 bits (76), Expect = 3.4 Identities = 22/89 (24%), Positives = 44/89 (49%), Gaps = 3/89 (3%) Frame = +2 Query: 230 QSEDTIKLKDNHAVSKRLQKELMELMRCSDKGISAFPXKRKPLQMDRDHQWTFXKLYTQA 409 Q+E +++ + + +RL ++L+E+ + D+ + R+ ++ D Q K + A Sbjct: 422 QNEHQLQVAEKQSEMERLTEQLLEVEKQKDEHNNTIGKLRQEIKDTVDGQRILEKKGSSA 481 Query: 410 T---NTNYHLNFQIHTHTHHLFVKFMTPC 487 +T+ H + HTHTH L + T C Sbjct: 482 VRTFHTHTHTHTHTHTHTHTLQSEKETEC 510 >UniRef50_Q38FP6 Cluster: Putative uncharacterized protein; n=1; Trypanosoma brucei|Rep: Putative uncharacterized protein - Trypanosoma brucei Length = 180 Score = 34.7 bits (76), Expect = 3.4 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = +2 Query: 425 HLNFQI--HTHTHHLFVKFMTPCFSSKC*HVWL 517 H N+QI HTHTH LF F+ C+S H+ L Sbjct: 80 HHNYQIRTHTHTHLLFFSFLPSCYSQLYSHIAL 112 >UniRef50_A2QMZ8 Cluster: Ubiquitin carrier protein; n=7; Pezizomycotina|Rep: Ubiquitin carrier protein - Aspergillus niger Length = 255 Score = 34.7 bits (76), Expect = 3.4 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 13/62 (20%) Frame = +3 Query: 483 PVFHPNVDTCGLICLDIL-------------KDKWTALYDVRTVLLSIQSLLAEPNTQSP 623 P++HPN+ G +C+ IL ++W+ V +VL+SI SLL + SP Sbjct: 96 PLYHPNIYKDGKLCISILHAPGEDEMSGELASERWSPAQRVESVLISILSLLDDAEISSP 155 Query: 624 LN 629 N Sbjct: 156 AN 157 >UniRef50_UPI000150A88B Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin-conjugating enzyme family protein - Tetrahymena thermophila SB210 Length = 486 Score = 34.3 bits (75), Expect = 4.5 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +3 Query: 486 VFHPNVDTCGLICLDILKDKWT-ALYDVRTVLLSIQSLLAEPNTQSPLNSSS 638 +FHPNV G IC++ LK W + + I+ LL P +S LN + Sbjct: 87 IFHPNVSEKGEICVNTLKKDWNHQSWSFYNIFEVIKCLLIIPFPESALNEEA 138 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 582,388,501 Number of Sequences: 1657284 Number of extensions: 10664856 Number of successful extensions: 28316 Number of sequences better than 10.0: 259 Number of HSP's better than 10.0 without gapping: 26601 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28006 length of database: 575,637,011 effective HSP length: 101 effective length of database: 408,251,327 effective search space used: 85324527343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -