BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_C17 (933 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenin... 29 0.20 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 25 4.3 >AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenine transaminase protein. Length = 396 Score = 29.1 bits (62), Expect = 0.20 Identities = 23/58 (39%), Positives = 29/58 (50%), Gaps = 12/58 (20%) Frame = -2 Query: 386 RSIDGPD--PFE-EVFAX-----QGMLIFLYHCTA----LAPLALSGVVCSQHDCLLV 249 R+I+GP PF E A Q +FL H + L PL G +C QHDCLL+ Sbjct: 120 RTIEGPPDRPFSLETLARAIELHQPKCLFLTHGDSSSGLLQPLEGVGQICHQHDCLLI 177 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 24.6 bits (51), Expect = 4.3 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 54 NHXTSNXIVAXSNSTGSXRRXTEKLVSLAILSKC 155 +H T+ V ++TGS R ++ L+ +A +KC Sbjct: 172 HHRTTGVFVTRHSTTGSSVRPSKGLIPVAPGAKC 205 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 637,904 Number of Sequences: 2352 Number of extensions: 12313 Number of successful extensions: 37 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 101708946 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -