BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_C17 (933 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 23 4.0 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 23 4.0 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 23 4.0 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 9.2 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 23.0 bits (47), Expect = 4.0 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = -1 Query: 315 LHRISSISSFWSRLLTA*LSFSLIVSSLCLAGFEDD 208 +H SS +W + L +LI+ + ++ F DD Sbjct: 81 IHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDD 116 Score = 22.2 bits (45), Expect = 6.9 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 97 QXVXAAXLKNWCPLLF*ASVHLISLKYYGSK 189 Q V + LKN LF + + +++K +GSK Sbjct: 33 QEVKQSFLKNQLQALFQPTDNKLAMKLFGSK 63 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 23.0 bits (47), Expect = 4.0 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = -1 Query: 315 LHRISSISSFWSRLLTA*LSFSLIVSSLCLAGFEDD 208 +H SS +W + L +LI+ + ++ F DD Sbjct: 81 IHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDD 116 Score = 22.2 bits (45), Expect = 6.9 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 97 QXVXAAXLKNWCPLLF*ASVHLISLKYYGSK 189 Q V + LKN LF + + +++K +GSK Sbjct: 33 QEVKQSFLKNQLQALFQPTDNKLAMKLFGSK 63 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 23.0 bits (47), Expect = 4.0 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = -1 Query: 315 LHRISSISSFWSRLLTA*LSFSLIVSSLCLAGFEDD 208 +H SS +W + L +LI+ + ++ F DD Sbjct: 81 IHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDD 116 Score = 22.2 bits (45), Expect = 6.9 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 97 QXVXAAXLKNWCPLLF*ASVHLISLKYYGSK 189 Q V + LKN LF + + +++K +GSK Sbjct: 33 QEVKQSFLKNQLQALFQPTDNKLAMKLFGSK 63 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.8 bits (44), Expect = 9.2 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +2 Query: 575 IVVNPKSFSRTKYTKPFKQQ 634 + +NP+ +++KPFK Q Sbjct: 523 LTINPERAEFIEFSKPFKYQ 542 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,650 Number of Sequences: 438 Number of extensions: 3296 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 30476628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -