BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_C06 (955 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z79602-1|CAB01888.3| 508|Caenorhabditis elegans Hypothetical pr... 36 0.056 AF026212-2|AAF99972.1| 1009|Caenorhabditis elegans Hypothetical ... 33 0.30 U41278-4|AAK31513.3| 928|Caenorhabditis elegans Hypothetical pr... 30 2.8 AC006733-8|AAF60490.1| 600|Caenorhabditis elegans Hypothetical ... 29 3.7 >Z79602-1|CAB01888.3| 508|Caenorhabditis elegans Hypothetical protein K09E9.1 protein. Length = 508 Score = 35.5 bits (78), Expect = 0.056 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = -1 Query: 436 PMIFVCSRVVSIGHFLLLYFVFLRLSSVNTLVAGLHVLCGG 314 P+ C +++IGH LL + ++L ++N +A + CGG Sbjct: 144 PVYLGCLLMITIGHILLTFSMYLSWMTINATLAAMGFFCGG 184 >AF026212-2|AAF99972.1| 1009|Caenorhabditis elegans Hypothetical protein F52G3.4 protein. Length = 1009 Score = 33.1 bits (72), Expect = 0.30 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 Query: 493 ENLDIGPMTTICRYCNALKFKRETAGLCCASGKV 594 E LDIG T C +C AL F+ CC +G V Sbjct: 176 EVLDIGQRTVPCPFCGALHFEDARNFTCCKNGAV 209 >U41278-4|AAK31513.3| 928|Caenorhabditis elegans Hypothetical protein F33G12.5 protein. Length = 928 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 331 ASQQQVYSQNLSEERQNIIRENARLRQRVST 423 ASQ+ SQ EE Q I++ N L++ +ST Sbjct: 541 ASQESAASQEQREESQEIVKLNEELKENIST 571 >AC006733-8|AAF60490.1| 600|Caenorhabditis elegans Hypothetical protein Y32H12A.7 protein. Length = 600 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 657 RFQPFSSTHPXNTITAFA*LLWRYII 734 RF P T+P I AF L WRY++ Sbjct: 100 RFSPILLTYPLTKIEAFENLWWRYLL 125 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,853,081 Number of Sequences: 27780 Number of extensions: 373122 Number of successful extensions: 1044 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1009 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1044 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2475644248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -