BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_C05 (939 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146716-1|AAO12076.1| 159|Anopheles gambiae odorant-binding pr... 25 4.4 DQ182013-1|ABA56305.1| 75|Anopheles gambiae G(alpha)c protein. 24 7.6 >AY146716-1|AAO12076.1| 159|Anopheles gambiae odorant-binding protein AgamOBP12 protein. Length = 159 Score = 24.6 bits (51), Expect = 4.4 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -2 Query: 518 LRYPLILWITVLPPLSELIP 459 +RY +LW+ +L +S L+P Sbjct: 4 VRYHFVLWLLILIGVSSLVP 23 >DQ182013-1|ABA56305.1| 75|Anopheles gambiae G(alpha)c protein. Length = 75 Score = 23.8 bits (49), Expect = 7.6 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +1 Query: 172 YIDEFGQTTTXMQ*KKCFICEICDAIALFVT 264 ++D GQ T + KCF C + + L T Sbjct: 13 FVDVGGQRTQRQKWTKCFDCSVTSILFLVST 43 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 676,895 Number of Sequences: 2352 Number of extensions: 11931 Number of successful extensions: 65 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 102535848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -