BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_C03 (919 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27622| Best HMM Match : Ribosomal_S25 (HMM E-Value=0) 132 3e-31 SB_5737| Best HMM Match : DED (HMM E-Value=2.9e-18) 28 9.2 >SB_27622| Best HMM Match : Ribosomal_S25 (HMM E-Value=0) Length = 115 Score = 132 bits (320), Expect = 3e-31 Identities = 68/115 (59%), Positives = 78/115 (67%) Frame = +2 Query: 113 PPKKDAKASAKQPQXXXXXXXXXXXXXXXXXXXXXXXXXXXLNNQVLFDKPTYEKLYKEV 292 PPKKD K AK+PQ LNN VLFDK TY+KLYKEV Sbjct: 1 PPKKDPKKDAKKPQKAQKPAGSGGGKAKKKKWSKGKVRDK-LNNLVLFDKATYDKLYKEV 59 Query: 293 PQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQHHGQVIYTRATKGDD 457 P Y+LITP+VVSERLK+RGSLARRAL+EL+ KGLIK+V +HH Q+IYTRATKG D Sbjct: 60 PSYRLITPSVVSERLKIRGSLARRALLELQSKGLIKEVSKHHSQLIYTRATKGAD 114 >SB_5737| Best HMM Match : DED (HMM E-Value=2.9e-18) Length = 1719 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = -3 Query: 200 SWLCRHRILPSSSVFFEAVWPKPSRPSWAASLNWKETIDNKQVAFV 63 SW CRH ++ S + + + SRP NWK + K + FV Sbjct: 1035 SWYCRHNLI-SKEILRQLL----SRPYGINEENWKNKLAEKAIDFV 1075 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,090,981 Number of Sequences: 59808 Number of extensions: 332655 Number of successful extensions: 1016 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 857 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1014 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2657535823 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -