BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_C03 (919 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41558-4|AAK39246.1| 117|Caenorhabditis elegans Ribosomal prote... 113 2e-25 Z81486-10|CAB03993.3| 681|Caenorhabditis elegans Hypothetical p... 29 3.5 >U41558-4|AAK39246.1| 117|Caenorhabditis elegans Ribosomal protein, small subunitprotein 25 protein. Length = 117 Score = 113 bits (272), Expect = 2e-25 Identities = 62/118 (52%), Positives = 70/118 (59%) Frame = +2 Query: 110 MPPKKDAKASAKQPQXXXXXXXXXXXXXXXXXXXXXXXXXXXLNNQVLFDKPTYEKLYKE 289 MPPKKD K P LNN VLFD+ TY+KLYKE Sbjct: 1 MPPKKDPKGGKAPPSKKKEGSGGGKAKKKKWSKGKVRDK---LNNMVLFDQATYDKLYKE 57 Query: 290 VPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQHHGQVIYTRATKGDDPV 463 V YKLITP+VVSERLKVR SLA+ L EL+ KGL+K VV HHGQV+YTRATK D + Sbjct: 58 VITYKLITPSVVSERLKVRASLAKAGLKELQAKGLVKCVVHHHGQVVYTRATKEADVI 115 >Z81486-10|CAB03993.3| 681|Caenorhabditis elegans Hypothetical protein C53A5.13 protein. Length = 681 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 121 EGREGFGQTASKNTEEEGRIRWRQSQEEEVVQRK 222 E REG G + + RIRW+ +EE+V R+ Sbjct: 25 EDREGDGVDVIEVRNDAIRIRWKHDSDEEIVTRQ 58 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,582,396 Number of Sequences: 27780 Number of extensions: 248842 Number of successful extensions: 730 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 730 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2349764032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -