BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_C03 (919 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g34555.1 68417.m04910 40S ribosomal protein S25, putative 93 2e-19 At4g39200.1 68417.m05550 40S ribosomal protein S25 (RPS25E) ribo... 91 7e-19 At2g21580.1 68415.m02567 40S ribosomal protein S25 (RPS25B) 91 7e-19 At2g16360.1 68415.m01872 40S ribosomal protein S25 (RPS25A) 85 8e-17 At4g27630.1 68417.m03971 expressed protein 30 2.5 At1g14500.1 68414.m01719 ankyrin repeat family protein contains ... 29 5.7 At1g63150.1 68414.m07137 pentatricopeptide (PPR) repeat-containi... 28 7.5 At1g62910.1 68414.m07103 pentatricopeptide (PPR) repeat-containi... 28 7.5 At2g17250.1 68415.m01992 expressed protein weak similarity to Ri... 28 10.0 At1g76910.1 68414.m08953 hypothetical protein 28 10.0 >At4g34555.1 68417.m04910 40S ribosomal protein S25, putative Length = 108 Score = 93.1 bits (221), Expect = 2e-19 Identities = 42/72 (58%), Positives = 55/72 (76%) Frame = +2 Query: 236 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQH 415 +NN VLFD+ TY+KL E P++KLITP+++S+RL++ GSLARRA+ EL KG I+ V H Sbjct: 37 VNNMVLFDQATYDKLLSEAPKFKLITPSILSDRLRINGSLARRAIRELMAKGTIRMVSAH 96 Query: 416 HGQVIYTRATKG 451 Q IYTRAT G Sbjct: 97 SSQQIYTRATHG 108 >At4g39200.1 68417.m05550 40S ribosomal protein S25 (RPS25E) ribosomal protein S25, Lycopersicon esculentum, PIR2:S40089 Length = 108 Score = 91.5 bits (217), Expect = 7e-19 Identities = 40/70 (57%), Positives = 55/70 (78%) Frame = +2 Query: 236 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQH 415 +NN VLFD+ TY+KL E P++KLITP+++S+R+++ GSLARRA+ EL KG+I+ V H Sbjct: 37 VNNMVLFDQATYDKLLTEAPKFKLITPSILSDRMRINGSLARRAIRELMAKGVIRMVAAH 96 Query: 416 HGQVIYTRAT 445 Q IYTRAT Sbjct: 97 SSQQIYTRAT 106 >At2g21580.1 68415.m02567 40S ribosomal protein S25 (RPS25B) Length = 108 Score = 91.5 bits (217), Expect = 7e-19 Identities = 41/70 (58%), Positives = 55/70 (78%) Frame = +2 Query: 236 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQH 415 +NN VLFD+ TY+KL E P++KLITP+++S+R+++ GSLARRA+ EL KGLI+ V H Sbjct: 37 VNNMVLFDQGTYDKLLTEAPKFKLITPSILSDRMRINGSLARRAIRELMAKGLIRMVSAH 96 Query: 416 HGQVIYTRAT 445 Q IYTRAT Sbjct: 97 SSQQIYTRAT 106 >At2g16360.1 68415.m01872 40S ribosomal protein S25 (RPS25A) Length = 125 Score = 84.6 bits (200), Expect = 8e-17 Identities = 38/70 (54%), Positives = 53/70 (75%) Frame = +2 Query: 236 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQH 415 +NN VLFD+ TY+KL E P++KLITP+++S+RL++ GSLAR+A+ +L KG I+ V H Sbjct: 53 VNNMVLFDQATYDKLMSEAPKFKLITPSILSDRLRINGSLARKAIRDLMVKGTIRMVSTH 112 Query: 416 HGQVIYTRAT 445 Q I TRAT Sbjct: 113 SSQQINTRAT 122 >At4g27630.1 68417.m03971 expressed protein Length = 348 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = -2 Query: 429 ITCP*CWTTCLMRPFSLSSMSALLAREPRTFNLSDTTAGVISLYCGTSLYSFSYVGL 259 I P CWTT L PF L ++ R + T V+S + +L +SY+ L Sbjct: 4 ILSPTCWTTLLKHPFILKGFFSMPQLVSRIGVIGVTLMAVLSGFGAVNL-PYSYISL 59 >At1g14500.1 68414.m01719 ankyrin repeat family protein contains Pfam domain, PF00023: Ankyrin repeat Length = 436 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/49 (24%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = -2 Query: 300 YCGTSLYSFSYVGLSN--NTWLFNLSRTFPLDHFFFLALPPPDPSFFFC 160 +C LY+F + + + TW F + + + + +A+ P+P F C Sbjct: 342 FCCALLYTFCLLPIGSLFTTWFFWIGASLGVSYALAMAIISPNPLLFLC 390 >At1g63150.1 68414.m07137 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 629 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -2 Query: 189 PPPDPSFFFCVF*GCLAEAFASFLGGIFELERN 91 PP PSFF GC +FAS G E+ RN Sbjct: 24 PPTVPSFFNLCGSGCWERSFASASGDYREILRN 56 >At1g62910.1 68414.m07103 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 1133 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -2 Query: 189 PPPDPSFFFCVF*GCLAEAFASFLGGIFELERN 91 PP PSFF GC +FAS G E+ RN Sbjct: 24 PPTVPSFFNLCGSGCWERSFASASGDYREILRN 56 >At2g17250.1 68415.m01992 expressed protein weak similarity to Ribosome biogenesis protein MAK21 (Swiss-Prot:Q12176) [Saccharomyces cerevisiae] Length = 577 Score = 27.9 bits (59), Expect = 10.0 Identities = 13/47 (27%), Positives = 29/47 (61%) Frame = +2 Query: 239 NNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIEL 379 +++ + +KPT +K E L++PA +S+R+K++ + A + + L Sbjct: 245 SDESISEKPTDKKKKTEKGDSTLLSPATISKRMKLKFTKAWISFLRL 291 >At1g76910.1 68414.m08953 hypothetical protein Length = 139 Score = 27.9 bits (59), Expect = 10.0 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 164 SVFFEAVWPKPSRPSWAASLNWKETIDN 81 S FF+ W + RP L+W ET+ N Sbjct: 14 SEFFQERWRRKPRPVITRMLHWTETVTN 41 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,885,888 Number of Sequences: 28952 Number of extensions: 230562 Number of successful extensions: 712 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 712 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2178500352 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -