BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_C01 (896 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY800250-1|AAV68043.1| 97|Anopheles gambiae thioredoxin depend... 26 1.8 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 9.5 >AY800250-1|AAV68043.1| 97|Anopheles gambiae thioredoxin dependent peroxidase protein. Length = 97 Score = 25.8 bits (54), Expect = 1.8 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = -1 Query: 722 ELLPSFNDIGLWMRKRSKTPSPGLPVKSCRPSPPDRCDGMYSTIYP 585 E+L + + + L ++R TP+ +P SC P D + +T++P Sbjct: 31 EILRTIDSMQLTDKRRVATPADWMPGDSCMVQPTVPADQL-ATLFP 75 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.4 bits (48), Expect = 9.5 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 235 RERAAALGQRQTEARHGXPHR 297 RER AAL + E+RH H+ Sbjct: 3257 RERIAALSEELEESRHILQHK 3277 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 755,964 Number of Sequences: 2352 Number of extensions: 15584 Number of successful extensions: 33 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 96747534 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -