BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_C01 (896 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 26 0.54 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 22 6.6 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 22 6.6 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 8.7 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 25.8 bits (54), Expect = 0.54 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = -3 Query: 702 RHRIVDEEEVENSKPRSASEILQAVSTRSVRWNVLHNLPIMKSSSRLTVPSS 547 RHR ++ E EN +PR I +A S R+ R + N S PSS Sbjct: 228 RHRNLEATESENVRPRRNVLIERAKSIRARRTECVTNSVTCDRPSDEAEPSS 279 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 22.2 bits (45), Expect = 6.6 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = -3 Query: 735 YLRYRTVAFLQRHRIVDEEEVENSKPRSASEILQAVSTRS 616 Y RY+ + R +EE + +K R SE+ S S Sbjct: 164 YCRYQKCLAMGMKREAVQEERQRTKERDQSEVESTSSLHS 203 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 22.2 bits (45), Expect = 6.6 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = -3 Query: 735 YLRYRTVAFLQRHRIVDEEEVENSKPRSASEILQAVSTRS 616 Y RY+ + R +EE + +K R SE+ S S Sbjct: 164 YCRYQKCLAMGMKREAVQEERQRTKERDQSEVESTSSLHS 203 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.8 bits (44), Expect = 8.7 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -3 Query: 417 VPKAMTGMNVPSR 379 VPK++ G+NV SR Sbjct: 239 VPKSVAGLNVSSR 251 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,162 Number of Sequences: 438 Number of extensions: 3937 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29025360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -