BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_B24 (940 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82256-2|CAB05115.1| 62|Caenorhabditis elegans Hypothetical pr... 57 2e-08 AL032657-13|CAB76744.1| 87|Caenorhabditis elegans Hypothetical... 48 1e-05 AL032625-6|CAN86641.1| 167|Caenorhabditis elegans Hypothetical ... 45 7e-05 >Z82256-2|CAB05115.1| 62|Caenorhabditis elegans Hypothetical protein B0513.3 protein. Length = 62 Score = 56.8 bits (131), Expect = 2e-08 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +2 Query: 98 MAKSKNHTNHNQNRKAHRNGIKKPRK 175 MAKSKNHTNHNQN+KAHRNGI KP+K Sbjct: 1 MAKSKNHTNHNQNKKAHRNGITKPKK 26 >AL032657-13|CAB76744.1| 87|Caenorhabditis elegans Hypothetical protein Y47H9C.14 protein. Length = 87 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/36 (58%), Positives = 26/36 (72%) Frame = +2 Query: 104 KSKNHTNHNQNRKAHRNGIKKPRKTRHESTLVHGSK 211 K +NHTNHN+N KAHRNGI KP+K H + GS+ Sbjct: 14 KPENHTNHNRNNKAHRNGITKPKK--HIFLSIEGSR 47 >AL032625-6|CAN86641.1| 167|Caenorhabditis elegans Hypothetical protein Y37H9A.5 protein. Length = 167 Score = 45.2 bits (102), Expect = 7e-05 Identities = 30/69 (43%), Positives = 34/69 (49%) Frame = +2 Query: 104 KSKNHTNHNQNRKAHRNGIKKPRKTRHESTLVHGSKIFNGIKGFARRVT*SQPSNSRGRL 283 KSKNHTNHNQN AHR GI KP KIF I+G R+V P Sbjct: 80 KSKNHTNHNQNNTAHRIGITKP-------------KIFLSIEGSRRQVHQEPPLRGSRLP 126 Query: 284 REKLPEKQR 310 + K+P QR Sbjct: 127 QCKIPRLQR 135 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,376,469 Number of Sequences: 27780 Number of extensions: 133285 Number of successful extensions: 438 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 438 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2423194158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -