BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_B23 (879 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 24 1.4 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 24 1.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 1.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 1.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 24 1.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 24 1.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 24 1.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 24 1.8 AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 22 5.5 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 9.7 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 21 9.7 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 24.2 bits (50), Expect = 1.4 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 120 AHFKNKCSNKLKKAWSRFLVYFF 52 AH K+K + KK WS+ + +F Sbjct: 109 AHLKDKKKIRAKKRWSQCMYMYF 131 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 24.2 bits (50), Expect = 1.4 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 120 AHFKNKCSNKLKKAWSRFLVYFF 52 AH K+K + KK WS+ + +F Sbjct: 423 AHLKDKKKIRAKKRWSQCMYMYF 445 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 24.2 bits (50), Expect = 1.4 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 120 AHFKNKCSNKLKKAWSRFLVYFF 52 AH K+K + KK WS+ + +F Sbjct: 656 AHLKDKKKIRAKKRWSQCMYMYF 678 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 24.2 bits (50), Expect = 1.4 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 120 AHFKNKCSNKLKKAWSRFLVYFF 52 AH K+K + KK WS+ + +F Sbjct: 656 AHLKDKKKIRAKKRWSQCMYMYF 678 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/35 (25%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = -1 Query: 120 AHFKNKCSNKLKKAWSRFLVYFFF--SKILRIPYS 22 AH K+K + +K WS+ + ++ +++ +P S Sbjct: 684 AHLKDKMKIRHRKRWSQVMYMYYLLGHRLMELPIS 718 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/35 (25%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = -1 Query: 120 AHFKNKCSNKLKKAWSRFLVYFFF--SKILRIPYS 22 AH K+K + +K WS+ + ++ +++ +P S Sbjct: 684 AHLKDKMKIRHRKRWSQVMYMYYLLGHRLMELPIS 718 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/35 (25%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = -1 Query: 120 AHFKNKCSNKLKKAWSRFLVYFFF--SKILRIPYS 22 AH K+K + +K WS+ + ++ +++ +P S Sbjct: 684 AHLKDKMKIRHRKRWSQVMYMYYLLGHRLMELPIS 718 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/35 (25%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = -1 Query: 120 AHFKNKCSNKLKKAWSRFLVYFFF--SKILRIPYS 22 AH K+K + +K WS+ + ++ +++ +P S Sbjct: 684 AHLKDKMKIRHRKRWSQVMYMYYLLGHRLMELPIS 718 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 22.2 bits (45), Expect = 5.5 Identities = 18/64 (28%), Positives = 27/64 (42%) Frame = +3 Query: 426 YDKLLFSWTRGRGYDVFARLSTVVG*N*DL*LLY*LNPHYRSKRSNRPILFSIMITVLFT 605 YD L ++ G GYD+ AR + L LN H ++ + + I T Sbjct: 69 YDPALAAYGYGAGYDLAARRKNATRES-TATLKAWLNEHKKNPYPTKGEKIMLAIITKMT 127 Query: 606 LTKV 617 LT+V Sbjct: 128 LTQV 131 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 9.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 798 ECRDLLYETNTTISNANKKNYLFIY 724 E D L+E NTT+ N++ F Y Sbjct: 801 EICDFLHEDNTTLVWDNEQQVPFAY 825 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 141 QNNKNYSAHFKNKCS 97 Q N NYS++ K CS Sbjct: 84 QQNSNYSSNSKPDCS 98 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,681 Number of Sequences: 336 Number of extensions: 3801 Number of successful extensions: 15 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24306755 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -