BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_B23 (879 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC15D4.05 |||conserved protein|Schizosaccharomyces pombe|chr 2... 27 2.7 SPAC23H3.03c |||nitrogen permease regulator family|Schizosacchar... 27 3.5 >SPBC15D4.05 |||conserved protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 411 Score = 27.5 bits (58), Expect = 2.7 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = -3 Query: 709 GVTSLKYTACTITNLMNIVKRDS*NIKTVKQTFVSVNRTVIIIENKIGR 563 G + + C I N +++ ++ + V+QT + +N IIE GR Sbjct: 205 GFIQISHADCLILNKTDLISSEA--LSVVRQTILKINCLAKIIETTYGR 251 >SPAC23H3.03c |||nitrogen permease regulator family|Schizosaccharomyces pombe|chr 1|||Manual Length = 409 Score = 27.1 bits (57), Expect = 3.5 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = +3 Query: 540 HYRSKRSNRPILFSIMITVLFTLTKVCFTVLMF*ESRLTIFIKL 671 HY S + RP++FS++ +L + C ++ + + +I IKL Sbjct: 137 HYISDLNKRPVIFSVIEQILEDMNNFCECMIQL-DDQNSINIKL 179 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,069,998 Number of Sequences: 5004 Number of extensions: 60191 Number of successful extensions: 125 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 125 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 440481800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -