BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_B23 (879 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 25 3.0 AY146726-1|AAO12086.1| 136|Anopheles gambiae odorant-binding pr... 24 5.3 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 25.0 bits (52), Expect = 3.0 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -3 Query: 337 AIHNI*CYLIFVRFFIFSKYDINFF 263 A+ NI C L+F+ FIF+ + ++FF Sbjct: 1751 ALFNI-CLLLFLVMFIFAIFGMSFF 1774 >AY146726-1|AAO12086.1| 136|Anopheles gambiae odorant-binding protein AgamOBP19 protein. Length = 136 Score = 24.2 bits (50), Expect = 5.3 Identities = 10/36 (27%), Positives = 22/36 (61%) Frame = +1 Query: 439 CLVGREVAVMMSSRVSRPLWAETKTYNYYISSILII 546 C +++ ++ V+R ++A+TK + Y+S +L I Sbjct: 33 CQPKHKISDEVADAVNRGVFADTKDFKCYVSCLLDI 68 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 742,444 Number of Sequences: 2352 Number of extensions: 13202 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 94266828 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -