Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP02_F_B23
         (879 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g10360.1 68416.m01242 pumilio/Puf RNA-binding domain-containi...    29   5.4  

>At3g10360.1 68416.m01242 pumilio/Puf RNA-binding domain-containing
           protein similar to RNA binding protein PufA GB:AAD39751
           [Dictyostelium discoideum] and similar to Pumilio
           protein GB:A46221 [Drosophila sp.]
          Length = 1003

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 3/40 (7%)
 Frame = -1

Query: 117 HFKNKCSNKLKKAWSRFLVYFFFSKILRI---PYSXAVXE 7
           H   KC  +L + W +F++  F+ K+L +   PY   V +
Sbjct: 788 HVIQKCIERLPQDWIQFIISSFYGKVLALSTHPYGCRVIQ 827


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,693,039
Number of Sequences: 28952
Number of extensions: 264616
Number of successful extensions: 439
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 433
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 439
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 2067932800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)