BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_B20 (952 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g30530.1 68414.m03735 UDP-glucoronosyl/UDP-glucosyl transfera... 33 0.37 At2g47410.1 68415.m05917 transducin family protein / WD-40 repea... 31 1.1 At5g17050.1 68418.m01998 UDP-glucoronosyl/UDP-glucosyl transfera... 30 2.6 At5g65760.1 68418.m08275 serine carboxypeptidase S28 family prot... 29 4.5 At1g17270.1 68414.m02103 expressed protein 29 4.5 At5g17030.1 68418.m01996 UDP-glucoronosyl/UDP-glucosyl transfera... 29 6.0 At2g32320.1 68415.m03951 expressed protein contains Pfam profil... 28 7.9 >At1g30530.1 68414.m03735 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 453 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -1 Query: 223 RISHGCFSVHTKKAPEAPGYVHWGTVPGPPP 131 R HGCF+ K++ + Y+ +GTV PPP Sbjct: 256 RDPHGCFAWMGKRSAASVAYISFGTVMEPPP 286 >At2g47410.1 68415.m05917 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to WDR protein, form B (GI:14970593) [Mus musculus] Length = 1589 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/86 (23%), Positives = 35/86 (40%), Gaps = 1/86 (1%) Frame = +1 Query: 454 LPNEINGWFWTAELQKLAPTTNRQQN-DWSEGGGIGKPQPDNRELIQGGASEHCVAILNN 630 LP I+ +W E + L+ + + N + S G P ++ ++ + + V N Sbjct: 821 LPEFIDAMYWEPEHEVLSDDNDSEYNAEVSSDGARASPCSNSSNELECSSEDSDV---EN 877 Query: 631 FYNDGVHWARRRLPPPQTIRLRRKRR 708 + HW RRR P + RR Sbjct: 878 IHESSYHWKRRRKHPKVNVSTSSGRR 903 >At5g17050.1 68418.m01998 UDP-glucoronosyl/UDP-glucosyl transferase family protein similar to UDP glucose:flavonoid 3-o-glucosyltransferase, Vitis vinifera, EMBL:AF000372 Length = 460 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -1 Query: 214 HGCFSVHTKKAPEAPGYVHWGTVPGPPP 131 HGC + K++ + Y+ +GTV PPP Sbjct: 265 HGCLAWMEKRSSGSVAYISFGTVMTPPP 292 >At5g65760.1 68418.m08275 serine carboxypeptidase S28 family protein similar to SP|P42785 Lysosomal Pro-X carboxypeptidase precursor (EC 3.4.16.2) (Prolylcarboxypeptidase) (PRCP) (Proline carboxypeptidase) {Homo sapiens}; contains Pfam profile PF05577: Serine carboxypeptidase S28 Length = 515 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +1 Query: 436 CNRPDLLPNEINGWFWTAELQKLAPTTNRQQNDWSEGGG 552 C + D P+ ++GW W A + + P ++ Q+N G G Sbjct: 353 CFKLDDDPHGLDGWNWQACTEMVMPMSSNQENSMFPGYG 391 >At1g17270.1 68414.m02103 expressed protein Length = 564 Score = 29.1 bits (62), Expect = 4.5 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 4/63 (6%) Frame = +1 Query: 220 YADNKGYFFSWR-DPALRGVEEDWLSARNYCRQRCMDLVSL---ETSDENEWVKARIVQD 387 + D + +F S++ DP V+E L A N RQ+ + LVSL + + + + +V D Sbjct: 87 FTDTRTFFSSFKLDPMSSRVKESELQALNLLRQQQLALVSLLNRTNFNSSNAISSSVVID 146 Query: 388 KIK 396 +K Sbjct: 147 NVK 149 >At5g17030.1 68418.m01996 UDP-glucoronosyl/UDP-glucosyl transferase family protein similar to UDP glucose:flavonoid 3-o-glucosyltransferase from Vitis vinifera, EMBL:AF000372 Length = 459 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -1 Query: 214 HGCFSVHTKKAPEAPGYVHWGTVPGPPPLAQLIIRVPMSS 95 HGC + K++ + Y+ +G V PPP+ + I + S Sbjct: 264 HGCLAWIEKRSTASVAYIAFGRVATPPPVELVAIAQGLES 303 >At2g32320.1 68415.m03951 expressed protein contains Pfam profile: PF04446 family of unknown function (DUF549) Length = 243 Score = 28.3 bits (60), Expect = 7.9 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = -2 Query: 441 VASFEVTKTARCPNVLYLVLDNTRFDPFIFIAGLERY*VHAALSAVVSCAQPVFFD 274 V SFEV PN++ + +D F F + E+ +L+ + SCA V + Sbjct: 9 VKSFEVEDEVMFPNLIIIRIDGRDFSRFSQVHKFEKPNDETSLNLMNSCASSVLVE 64 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,094,095 Number of Sequences: 28952 Number of extensions: 426975 Number of successful extensions: 1230 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1230 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2285480280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -