BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_B17 (901 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2891| Best HMM Match : PAN (HMM E-Value=4.4e-05) 82 7e-16 >SB_2891| Best HMM Match : PAN (HMM E-Value=4.4e-05) Length = 271 Score = 81.8 bits (193), Expect = 7e-16 Identities = 36/66 (54%), Positives = 46/66 (69%) Frame = +3 Query: 378 PIKCNTNIRLQHVATKKNLHSHFFTSPLSGNQXVSCYGXXXGEXDSGNNWTVVCTMTTWR 557 PIKC+ IRLQH+ATK+NLHSH F SP+S NQ VS +G G D+ ++W VVC+ W Sbjct: 3 PIKCDETIRLQHLATKRNLHSHHFQSPISHNQEVSAFG-EGGNGDNLDDWVVVCSKKNWE 61 Query: 558 RKXPVK 575 RK V+ Sbjct: 62 RKDTVR 67 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,592,786 Number of Sequences: 59808 Number of extensions: 317229 Number of successful extensions: 524 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 523 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2586032617 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -