BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_B16 (1051 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 27 0.13 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 27 0.14 05_04_0011 + 17139322-17139451,17139552-17140174 27 0.15 01_07_0188 - 41866689-41866763,41866889-41867155,41867277-418677... 34 0.16 01_03_0076 - 12241408-12241545,12241719-12241790,12242173-122422... 33 0.50 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 27 0.82 02_04_0180 + 20696258-20698398,20698691-20698871,20698998-20699060 27 0.85 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 29 0.86 03_03_0038 + 13984525-13984917,13985351-13985429,13985535-139856... 27 0.93 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 27 1.1 04_04_0760 - 27837170-27837328,27837441-27837504,27837812-278381... 27 1.2 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 27 1.8 12_02_1174 - 26696869-26698191 29 4.7 12_02_1119 + 26213719-26213955,26214039-26214197,26214640-262147... 29 4.7 12_02_1070 - 25814741-25815850 29 4.7 12_02_1036 - 25587313-25587890,25589209-25589272,25589356-255894... 29 4.7 12_02_0859 - 23751198-23753258 29 4.7 12_02_0408 + 18659494-18660362,18660472-18660634,18660976-186611... 29 4.7 12_02_0299 - 17051570-17052474,17053542-17053755 29 4.7 12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758,417... 29 4.7 12_01_0495 - 3935395-3937110 29 4.7 12_01_0442 + 3495333-3496484 29 4.7 12_01_0373 + 2897874-2898911 29 4.7 12_01_0347 + 2658545-2659309 29 4.7 12_01_0319 + 2440129-2440661,2440875-2440902 29 4.7 11_06_0208 - 21268722-21268763,21269146-21269274,21269388-212695... 29 4.7 11_06_0081 + 19886848-19888050,19888243-19888896 29 4.7 11_06_0016 - 19284810-19284926,19285527-19286879 29 4.7 10_08_0534 + 18595520-18595828,18595917-18597149 29 4.7 10_08_0527 - 18555231-18555882,18556334-18556463,18557073-18557175 29 4.7 10_06_0180 + 11526139-11526172,11526365-11527218 29 4.7 10_06_0152 - 11280532-11281427,11281501-11281971,11282512-11282569 29 4.7 10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364,955... 29 4.7 10_03_0035 - 7265037-7265455,7265684-7265812,7265909-7265951,726... 29 4.7 10_03_0023 - 7151465-7152111,7152222-7152405 29 4.7 10_02_0134 + 5667236-5669295,5669833-5669902,5670266-5670376 29 4.7 10_02_0009 + 4128909-4130123 29 4.7 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 29 4.7 09_06_0149 - 21222976-21223065,21223460-21224173 29 4.7 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 29 4.7 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 29 4.7 09_04_0112 - 14757947-14758972 29 4.7 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 29 4.7 09_03_0130 - 12609417-12610462,12610786-12611040,12611139-126112... 29 4.7 09_02_0351 - 7686974-7686983,7687142-7687195,7687363-7687408,768... 29 4.7 09_02_0327 - 7284829-7284889,7284946-7286126 29 4.7 09_01_0037 - 604001-604957 29 4.7 09_01_0016 - 376742-376883,377973-378964 29 4.7 08_02_1256 + 25645085-25645396 29 4.7 08_02_1081 + 24215323-24215335,24215450-24215572,24216241-242164... 29 4.7 08_02_0937 + 22801526-22802461 29 4.7 08_02_0796 - 21300251-21300373,21300846-21301721 29 4.7 08_01_1081 + 11058119-11059756 29 4.7 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 29 4.7 08_01_0493 - 4297761-4298288 29 4.7 08_01_0420 + 3726392-3727116,3727450-3727648,3727787-3727879,372... 29 4.7 08_01_0204 + 1642169-1642687 29 4.7 08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147,160... 29 4.7 08_01_0060 - 413088-413999 29 4.7 07_03_1771 - 29404972-29405175,29405282-29405677 29 4.7 07_03_1381 - 26166673-26166747,26166972-26167544 29 4.7 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 29 4.7 07_03_0890 - 22332768-22333382 29 4.7 07_03_0154 + 14509979-14512033 29 4.7 07_03_0111 + 13535912-13535972,13536081-13536142,13536418-135365... 29 4.7 07_01_1123 - 10385215-10385574,10385676-10385810,10386385-103870... 29 4.7 07_01_0862 - 7172083-7172931 29 4.7 07_01_0753 - 5799733-5799741,5799938-5800642 29 4.7 07_01_0516 - 3850252-3852870 29 4.7 07_01_0321 - 2255342-2255604,2256506-2256779,2256886-2257068 29 4.7 07_01_0080 + 587674-588510 29 4.7 07_01_0015 + 108338-109186 29 4.7 06_03_1191 + 28286685-28287008,28287149-28287211,28287377-282874... 29 4.7 06_03_0750 - 24140988-24141037,24141108-24141345,24142158-241422... 29 4.7 06_03_0743 + 24069752-24070483,24071890-24072345 29 4.7 06_03_0696 + 23617687-23617851,23618838-23619536 29 4.7 06_03_0526 + 21771519-21771607,21771685-21771810,21771890-217720... 29 4.7 06_03_0214 + 18067945-18068463,18068940-18069839,18069918-18070652 29 4.7 06_02_0257 - 13533689-13533714,13533799-13533925,13534013-135341... 29 4.7 06_02_0024 - 10714741-10716241,10716774-10717840 29 4.7 06_01_0921 + 7104923-7105396,7106624-7106768,7107078-7107121 29 4.7 06_01_0561 - 3983308-3983564,3983652-3983775 29 4.7 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 29 4.7 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 29 4.7 05_07_0031 - 27183252-27183317,27183542-27184282 29 4.7 05_06_0051 - 25190803-25191216,25191301-25191891,25193248-251933... 29 4.7 05_05_0207 + 23272777-23272977,23273831-23275330 29 4.7 05_05_0181 + 23033059-23033775 29 4.7 05_04_0206 + 19034259-19035462,19036870-19037045,19037752-190379... 29 4.7 05_04_0160 - 18624952-18625106,18625411-18625535,18625954-186260... 29 4.7 05_01_0384 + 2997465-2999777,2999960-3000035,3003027-3003102,300... 29 4.7 05_01_0380 + 2978256-2979284 29 4.7 05_01_0210 + 1583176-1584177 29 4.7 05_01_0192 + 1394342-1396645 29 4.7 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 29 4.7 04_04_1687 - 35365766-35366356,35367137-35368135 29 4.7 04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 29 4.7 04_04_0887 + 29095087-29096166 29 4.7 04_04_0708 - 27441373-27442611 29 4.7 04_04_0198 + 23502657-23502900,23505228-23505298,23505690-235057... 29 4.7 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 29 4.7 04_04_0057 + 22410167-22411330 29 4.7 04_03_1022 - 21778315-21779007 29 4.7 04_03_0977 + 21381857-21383757,21384299-21384458,21384669-213847... 29 4.7 04_03_0243 - 13271384-13272865,13272987-13273248,13274617-13276067 29 4.7 04_01_0354 - 4646826-4647314 29 4.7 04_01_0246 + 3225743-3226473,3226493-3226624,3227580-3227670,322... 29 4.7 04_01_0197 + 2323790-2324098,2324145-2324774 29 4.7 03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 29 4.7 03_06_0600 + 34988743-34989407,34990033-34990051 29 4.7 03_06_0599 + 34984869-34985319,34986581-34987563 29 4.7 03_06_0411 + 33741903-33742163,33742990-33743168,33743342-337434... 29 4.7 03_05_1096 - 30364144-30365310,30365825-30365971,30366087-303663... 29 4.7 03_05_0918 - 28785233-28786613,28786894-28787140,28787773-28788238 29 4.7 03_05_0732 - 27232299-27232535,27232717-27232746,27233094-272331... 29 4.7 03_04_0042 - 16743440-16743454,16743907-16744002,16744257-167444... 29 4.7 03_02_0784 - 11154395-11154888,11155284-11155360,11155447-111554... 29 4.7 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 29 4.7 03_01_0219 + 1731267-1731728,1732148-1732235,1732330-1732417,173... 29 4.7 02_05_0925 - 32768815-32769654 29 4.7 02_05_0543 + 29872168-29872767,29873089-29873115 29 4.7 02_05_0002 - 24849189-24849825,24850267-24850328 29 4.7 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 29 4.7 02_04_0520 - 23628183-23628195,23629354-23630036 29 4.7 02_04_0312 - 21942310-21943356 29 4.7 02_03_0279 + 17250347-17252098 29 4.7 02_02_0489 + 10869482-10871218 29 4.7 02_02_0359 - 9390175-9390416,9390924-9391044,9391069-9391410,939... 29 4.7 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 29 4.7 02_01_0377 + 2728892-2729187,2729483-2729544,2730516-2730570,273... 29 4.7 02_01_0016 + 110796-110979,111252-111768,111847-112213 29 4.7 01_06_1805 - 39999987-40000169,40000648-40000974,40001724-400020... 29 4.7 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 29 4.7 01_06_1321 + 36280691-36281269 29 4.7 01_06_0883 + 32708037-32708558,32708627-32708911,32709661-32709675 29 4.7 01_06_0357 - 28668894-28669238,28669510-28669537,28669578-286696... 29 4.7 01_06_0090 + 26358051-26359157,26359582-26359701,26359968-263600... 29 4.7 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 29 4.7 01_05_0490 + 22672241-22674679 29 4.7 01_05_0423 + 22032940-22033695 29 4.7 01_01_1162 - 9253034-9254229,9254387-9254456,9254473-9254567,925... 29 4.7 01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827,896... 29 4.7 01_01_1001 - 7925858-7926559 29 4.7 01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593,703... 29 4.7 01_01_0889 + 7008077-7009261 29 4.7 01_01_0796 + 6190931-6192745 29 4.7 01_01_0761 - 5874953-5876803 29 4.7 01_01_0369 - 2886060-2886272,2886721-2887434 29 4.7 01_01_0046 - 331758-332627 29 4.7 02_05_0149 + 26290236-26290880 26 5.9 05_01_0131 + 888247-888771,889092-889154 24 5.9 02_02_0029 + 6204557-6204734,6205105-6205207,6205970-6206108 29 6.2 02_01_0062 - 448105-448145,448780-448866,449664-449790 29 6.2 01_01_0715 - 5542648-5543219,5543352-5543544 27 7.5 04_03_0800 - 19820886-19821421,19822476-19822563,19822871-19822888 24 7.6 01_06_1612 - 38635703-38636215,38638725-38638967 29 8.1 01_01_0517 + 3803740-3806106,3806226-3806312,3806397-3807035,380... 23 8.3 07_01_0389 - 2915191-2915604,2915696-2915752,2915867-2915922,291... 23 8.3 04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 23 8.5 04_04_1641 + 34993807-34994589,34994924-34995022,34995521-349956... 23 8.6 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 24 8.6 01_01_0720 - 5593311-5595371,5597550-5598027,5598118-5598146 24 8.7 10_08_0935 + 21670372-21671396,21672057-21672987 24 8.9 07_01_0973 - 8193002-8193261,8193388-8193485,8194117-8194401,819... 23 9.2 01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 23 9.2 07_03_1136 + 24218601-24218734,24218769-24219906 23 9.2 12_01_0473 + 3708770-3710026 23 9.3 01_06_1809 - 40029628-40030539 23 9.5 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 23 9.6 03_02_0350 - 7734494-7734952,7735765-7736133 23 9.6 02_04_0654 - 24755339-24755408,24755488-24755624,24756243-247563... 24 9.8 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 26.6 bits (56), Expect(2) = 0.13 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1050 PPPPPPPP 1027 PPPPPPPP Sbjct: 331 PPPPPPPP 338 Score = 26.6 bits (56), Expect(2) = 0.13 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1047 PPPPPPPP 1024 PPPPPPPP Sbjct: 348 PPPPPPPP 355 Score = 25.8 bits (54), Expect(2) = 5.2 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 644 PPPPPPXXFXNXNXK 688 PPPPPP F N K Sbjct: 333 PPPPPPSRFNNTTPK 347 Score = 21.8 bits (44), Expect(2) = 5.2 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +2 Query: 620 PXKKKXXXPPPPPP 661 P PPPPPP Sbjct: 323 PPSNPPPAPPPPPP 336 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 26.6 bits (56), Expect(2) = 0.14 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1050 PPPPPPPP 1027 PPPPPPPP Sbjct: 204 PPPPPPPP 211 Score = 26.6 bits (56), Expect(2) = 0.14 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1050 PPPPPPPP 1027 PPPPPPPP Sbjct: 230 PPPPPPPP 237 Score = 26.6 bits (56), Expect(2) = 0.14 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1047 PPPPPPPP 1024 PPPPPPPP Sbjct: 230 PPPPPPPP 237 Score = 26.6 bits (56), Expect(2) = 1.5 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1050 PPPPPPPP 1027 PPPPPPPP Sbjct: 251 PPPPPPPP 258 Score = 26.6 bits (56), Expect(2) = 0.14 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1047 PPPPPPPP 1024 PPPPPPPP Sbjct: 251 PPPPPPPP 258 Score = 23.0 bits (47), Expect(2) = 1.5 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 1047 PPPPPPPP 1024 PPPPPP P Sbjct: 273 PPPPPPRP 280 >05_04_0011 + 17139322-17139451,17139552-17140174 Length = 250 Score = 26.6 bits (56), Expect(2) = 0.15 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1050 PPPPPPPP 1027 PPPPPPPP Sbjct: 67 PPPPPPPP 74 Score = 26.6 bits (56), Expect(2) = 0.15 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1047 PPPPPPPP 1024 PPPPPPPP Sbjct: 103 PPPPPPPP 110 Score = 26.6 bits (56), Expect(2) = 7.5 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1047 PPPPPPPP 1024 PPPPPPPP Sbjct: 171 PPPPPPPP 178 Score = 20.6 bits (41), Expect(2) = 7.5 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = -2 Query: 1050 PPPPPPP 1030 PPPP PP Sbjct: 139 PPPPSPP 145 >01_07_0188 - 41866689-41866763,41866889-41867155,41867277-41867722, 41867945-41868033,41868279-41868368,41868661-41868739, 41868979-41869042,41869597-41869684,41869776-41869836, 41869906-41869969,41870134-41870188,41870275-41870346, 41870469-41870551,41870629-41870724,41871279-41871383, 41872159-41872227,41872470-41872561,41872667-41872886 Length = 704 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 621 LXKKKXXXPPPPPPXFX*IXXKKXXGGGGXFFXXXXPXPP 740 + +++ PPPPPP + GGGG F+ P PP Sbjct: 1 MMQQQQQPPPPPPPPQHPPPPQAGGGGGGEFYRGPPPQPP 40 Score = 28.7 bits (61), Expect = 8.1 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 644 PPPPPPXXFXNXNXKXXGGGGXXFXXXXSXPPXP 745 PPPPPP + GGGG F PP P Sbjct: 8 PPPPPPPPQHPPPPQAGGGGGGEF--YRGPPPQP 39 >01_03_0076 - 12241408-12241545,12241719-12241790,12242173-12242289, 12243307-12245127,12245361-12245810 Length = 865 Score = 32.7 bits (71), Expect = 0.50 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -2 Query: 1050 PPPPPPPPPXXXXXXXXXXXKXXKKKK 970 PPPPPPPPP K K+KK Sbjct: 130 PPPPPPPPPEESPYVLFSAHKVLKQKK 156 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 26.6 bits (56), Expect(2) = 0.82 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1047 PPPPPPPP 1024 PPPPPPPP Sbjct: 941 PPPPPPPP 948 Score = 23.8 bits (49), Expect(2) = 0.82 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1050 PPPPPPP 1030 PPPPPPP Sbjct: 929 PPPPPPP 935 >02_04_0180 + 20696258-20698398,20698691-20698871,20698998-20699060 Length = 794 Score = 26.6 bits (56), Expect(2) = 0.85 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1050 PPPPPPPP 1027 PPPPPPPP Sbjct: 11 PPPPPPPP 18 Score = 23.8 bits (49), Expect(2) = 0.85 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1044 PPPPPPP 1024 PPPPPPP Sbjct: 38 PPPPPPP 44 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 106 PPPPPPPPP 114 Score = 26.6 bits (56), Expect(2) = 0.86 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1047 PPPPPPPP 1024 PPPPPPPP Sbjct: 121 PPPPPPPP 128 Score = 23.8 bits (49), Expect(2) = 0.86 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1050 PPPPPPP 1030 PPPPPPP Sbjct: 92 PPPPPPP 98 >03_03_0038 + 13984525-13984917,13985351-13985429,13985535-13985628, 13985712-13985844 Length = 232 Score = 26.6 bits (56), Expect(2) = 0.93 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1047 PPPPPPPP 1024 PPPPPPPP Sbjct: 80 PPPPPPPP 87 Score = 23.8 bits (49), Expect(2) = 0.93 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1050 PPPPPPP 1030 PPPPPPP Sbjct: 38 PPPPPPP 44 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 26.6 bits (56), Expect(2) = 1.1 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1050 PPPPPPPP 1027 PPPPPPPP Sbjct: 52 PPPPPPPP 59 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 1047 PPPPPPPP 1024 P PPPPPP Sbjct: 62 PAPPPPPP 69 >04_04_0760 - 27837170-27837328,27837441-27837504,27837812-27838160, 27838906-27838960,27839489-27839821 Length = 319 Score = 26.6 bits (56), Expect(2) = 1.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1050 PPPPPPPP 1027 PPPPPPPP Sbjct: 9 PPPPPPPP 16 Score = 23.4 bits (48), Expect(2) = 1.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 1047 PPPPPPPP 1024 P PPPPPP Sbjct: 25 PKPPPPPP 32 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 26.6 bits (56), Expect(2) = 1.8 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1050 PPPPPPPP 1027 PPPPPPPP Sbjct: 1180 PPPPPPPP 1187 Score = 22.6 bits (46), Expect(2) = 1.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 1047 PPPPPPPP 1024 PPP PPPP Sbjct: 1205 PPPIPPPP 1212 >12_02_1174 - 26696869-26698191 Length = 440 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 153 PPPPPPPPP 161 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 154 PPPPPPPPP 162 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 155 PPPPPPPPP 163 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 156 PPPPPPPPP 164 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 157 PPPPPPPPP 165 >12_02_1119 + 26213719-26213955,26214039-26214197,26214640-26214702, 26214813-26214902,26214984-26215106,26215344-26215431, 26217043-26217117,26218109-26218215 Length = 313 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 14 PPPPPPPPP 22 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 15 PPPPPPPPP 23 >12_02_1070 - 25814741-25815850 Length = 369 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 9 PPPPPPPPP 17 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 237 PPPPPPPPP 245 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 238 PPPPPPPPP 246 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 239 PPPPPPPPP 247 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 240 PPPPPPPPP 248 >12_02_1036 - 25587313-25587890,25589209-25589272,25589356-25589448, 25589533-25589683,25590474-25590539,25590594-25590907 Length = 421 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 39 PPPPPPPPP 47 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 40 PPPPPPPPP 48 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 41 PPPPPPPPP 49 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 42 PPPPPPPPP 50 >12_02_0859 - 23751198-23753258 Length = 686 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 626 PPPPPPPPP 634 >12_02_0408 + 18659494-18660362,18660472-18660634,18660976-18661139, 18661253-18661511,18661605-18661712 Length = 520 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 145 PPPPPPPPP 153 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 146 PPPPPPPPP 154 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 320 PPPPPPPPP 328 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 321 PPPPPPPPP 329 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 322 PPPPPPPPP 330 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 323 PPPPPPPPP 331 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 324 PPPPPPPPP 332 >12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758, 4171814-4171891,4174482-4174569,4174659-4174850, 4174939-4175802 Length = 493 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 158 PPPPPPPPP 166 >12_01_0495 - 3935395-3937110 Length = 571 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 10 PPPPPPPPP 18 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 11 PPPPPPPPP 19 >12_01_0442 + 3495333-3496484 Length = 383 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 70 PPPPPPPPP 78 >12_01_0373 + 2897874-2898911 Length = 345 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 155 PPPPPPPPP 163 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 156 PPPPPPPPP 164 >12_01_0347 + 2658545-2659309 Length = 254 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 188 PPPPPPPPP 196 >12_01_0319 + 2440129-2440661,2440875-2440902 Length = 186 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 46 PPPPPPPPP 54 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 47 PPPPPPPPP 55 >11_06_0208 - 21268722-21268763,21269146-21269274,21269388-21269537, 21270402-21270773 Length = 230 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 18 PPPPPPPPP 26 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 19 PPPPPPPPP 27 >11_06_0081 + 19886848-19888050,19888243-19888896 Length = 618 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 262 PPPPPPPPP 270 >11_06_0016 - 19284810-19284926,19285527-19286879 Length = 489 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 87 PPPPPPPPP 95 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 88 PPPPPPPPP 96 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 89 PPPPPPPPP 97 >10_08_0534 + 18595520-18595828,18595917-18597149 Length = 513 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 35 PPPPPPPPP 43 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 36 PPPPPPPPP 44 >10_08_0527 - 18555231-18555882,18556334-18556463,18557073-18557175 Length = 294 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 201 PPPPPPPPP 209 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 202 PPPPPPPPP 210 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 203 PPPPPPPPP 211 >10_06_0180 + 11526139-11526172,11526365-11527218 Length = 295 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 169 PPPPPPPPP 177 >10_06_0152 - 11280532-11281427,11281501-11281971,11282512-11282569 Length = 474 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 320 PPPPPPPPP 328 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 321 PPPPPPPPP 329 >10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364, 9551969-9552097 Length = 921 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 338 PPPPPPPPP 346 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 339 PPPPPPPPP 347 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 340 PPPPPPPPP 348 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 341 PPPPPPPPP 349 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 342 PPPPPPPPP 350 >10_03_0035 - 7265037-7265455,7265684-7265812,7265909-7265951, 7266321-7266344 Length = 204 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 120 PPPPPPPPP 128 >10_03_0023 - 7151465-7152111,7152222-7152405 Length = 276 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 237 PPPPPPPPP 245 >10_02_0134 + 5667236-5669295,5669833-5669902,5670266-5670376 Length = 746 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 6 PPPPPPPPP 14 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 7 PPPPPPPPP 15 >10_02_0009 + 4128909-4130123 Length = 404 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 84 PPPPPPPPP 92 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 85 PPPPPPPPP 93 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 544 PPPPPPPPP 552 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 545 PPPPPPPPP 553 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 546 PPPPPPPPP 554 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 563 PPPPPPPPP 571 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 564 PPPPPPPPP 572 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 565 PPPPPPPPP 573 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 566 PPPPPPPPP 574 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 585 PPPPPPPPP 593 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 602 PPPPPPPPP 610 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 618 PPPPPPPPP 626 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 634 PPPPPPPPP 642 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 635 PPPPPPPPP 643 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 712 PPPPPPPPP 720 Score = 23.4 bits (48), Expect(2) = 8.4 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 1050 PPPPPPPP 1027 PP PPPPP Sbjct: 747 PPAPPPPP 754 Score = 23.4 bits (48), Expect(2) = 8.4 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 1047 PPPPPPPP 1024 P PPPPPP Sbjct: 762 PAPPPPPP 769 >09_06_0149 - 21222976-21223065,21223460-21224173 Length = 267 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 118 PPPPPPPPP 126 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 82 PPPPPPPPP 90 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 83 PPPPPPPPP 91 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 84 PPPPPPPPP 92 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 85 PPPPPPPPP 93 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 86 PPPPPPPPP 94 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 87 PPPPPPPPP 95 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 264 PPPPPPPPP 272 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 265 PPPPPPPPP 273 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 266 PPPPPPPPP 274 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 267 PPPPPPPPP 275 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 268 PPPPPPPPP 276 >09_04_0112 - 14757947-14758972 Length = 341 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 295 PPPPPPPPP 303 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 150 PPPPPPPPP 158 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 220 PPPPPPPPP 228 >09_03_0130 - 12609417-12610462,12610786-12611040,12611139-12611253, 12611376-12611428,12611854-12612114,12612252-12612302, 12612412-12612660,12612779-12613007,12613292-12613666 Length = 877 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 14 PPPPPPPPP 22 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 15 PPPPPPPPP 23 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 16 PPPPPPPPP 24 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 17 PPPPPPPPP 25 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 18 PPPPPPPPP 26 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 19 PPPPPPPPP 27 >09_02_0351 - 7686974-7686983,7687142-7687195,7687363-7687408, 7688179-7688280,7688683-7689284,7689599-7689783 Length = 332 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 70 PPPPPPPPP 78 >09_02_0327 - 7284829-7284889,7284946-7286126 Length = 413 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 53 PPPPPPPPP 61 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 54 PPPPPPPPP 62 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 55 PPPPPPPPP 63 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 56 PPPPPPPPP 64 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 57 PPPPPPPPP 65 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 58 PPPPPPPPP 66 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 59 PPPPPPPPP 67 >09_01_0037 - 604001-604957 Length = 318 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 192 PPPPPPPPP 200 >09_01_0016 - 376742-376883,377973-378964 Length = 377 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 60 PPPPPPPPP 68 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 61 PPPPPPPPP 69 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 62 PPPPPPPPP 70 >08_02_1256 + 25645085-25645396 Length = 103 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 61 PPPPPPPPP 69 >08_02_1081 + 24215323-24215335,24215450-24215572,24216241-24216489, 24218517-24218720,24218864-24218993,24219610-24219679, 24219766-24219900,24219996-24220209,24220314-24220455, 24220630-24220851,24220997-24221195 Length = 566 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 66 PPPPPPPPP 74 >08_02_0937 + 22801526-22802461 Length = 311 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 73 PPPPPPPPP 81 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 103 PPPPPPPPP 111 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 104 PPPPPPPPP 112 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 105 PPPPPPPPP 113 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 106 PPPPPPPPP 114 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 107 PPPPPPPPP 115 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 108 PPPPPPPPP 116 >08_01_1081 + 11058119-11059756 Length = 545 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 211 PPPPPPPPP 219 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 431 PPPPPPPPP 439 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 432 PPPPPPPPP 440 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 433 PPPPPPPPP 441 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 434 PPPPPPPPP 442 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 435 PPPPPPPPP 443 >08_01_0493 - 4297761-4298288 Length = 175 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 115 PPPPPPPPP 123 >08_01_0420 + 3726392-3727116,3727450-3727648,3727787-3727879, 3728001-3728129,3728445-3728498,3728597-3728674, 3728773-3728835,3729101-3729213,3729392-3729500 Length = 520 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 97 PPPPPPPPP 105 >08_01_0204 + 1642169-1642687 Length = 172 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 157 PPPPPPPPP 165 >08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147, 1602532-1602600 Length = 390 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 18 PPPPPPPPP 26 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 19 PPPPPPPPP 27 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 20 PPPPPPPPP 28 >08_01_0060 - 413088-413999 Length = 303 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 29 PPPPPPPPP 37 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 30 PPPPPPPPP 38 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 31 PPPPPPPPP 39 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 32 PPPPPPPPP 40 >07_03_1771 - 29404972-29405175,29405282-29405677 Length = 199 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 16 PPPPPPPPP 24 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 17 PPPPPPPPP 25 >07_03_1381 - 26166673-26166747,26166972-26167544 Length = 215 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 161 PPPPPPPPP 169 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 162 PPPPPPPPP 170 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 63 PPPPPPPPP 71 >07_03_0890 - 22332768-22333382 Length = 204 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 84 PPPPPPPPP 92 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 85 PPPPPPPPP 93 >07_03_0154 + 14509979-14512033 Length = 684 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 53 PPPPPPPPP 61 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 54 PPPPPPPPP 62 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 55 PPPPPPPPP 63 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 56 PPPPPPPPP 64 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 57 PPPPPPPPP 65 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 58 PPPPPPPPP 66 >07_03_0111 + 13535912-13535972,13536081-13536142,13536418-13536510, 13537577-13537649,13537876-13538265,13538337-13538404, 13539334-13539375,13540211-13540735,13540817-13540974, 13541078-13541636,13542438-13542500,13542579-13542680, 13542779-13543096,13543175-13543267,13543489-13543590, 13543678-13543782,13544190-13544323,13545097-13545280, 13545701-13545832,13546215-13546327,13546468-13546558, 13547138-13549339 Length = 1889 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 123 PPPPPPPPP 131 >07_01_1123 - 10385215-10385574,10385676-10385810,10386385-10387091, 10387158-10387455 Length = 499 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 9 PPPPPPPPP 17 >07_01_0862 - 7172083-7172931 Length = 282 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 127 PPPPPPPPP 135 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 128 PPPPPPPPP 136 >07_01_0753 - 5799733-5799741,5799938-5800642 Length = 237 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 43 PPPPPPPPP 51 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 44 PPPPPPPPP 52 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 45 PPPPPPPPP 53 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 46 PPPPPPPPP 54 >07_01_0516 - 3850252-3852870 Length = 872 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 27 PPPPPPPPP 35 >07_01_0321 - 2255342-2255604,2256506-2256779,2256886-2257068 Length = 239 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 37 PPPPPPPPP 45 >07_01_0080 + 587674-588510 Length = 278 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 91 PPPPPPPPP 99 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 104 PPPPPPPPP 112 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 105 PPPPPPPPP 113 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 106 PPPPPPPPP 114 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 107 PPPPPPPPP 115 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 108 PPPPPPPPP 116 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 109 PPPPPPPPP 117 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 110 PPPPPPPPP 118 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 111 PPPPPPPPP 119 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 112 PPPPPPPPP 120 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 113 PPPPPPPPP 121 >07_01_0015 + 108338-109186 Length = 282 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 105 PPPPPPPPP 113 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 106 PPPPPPPPP 114 >06_03_1191 + 28286685-28287008,28287149-28287211,28287377-28287461, 28287561-28287623,28287954-28288029,28288190-28288223, 28289553-28289659,28289738-28289807,28289852-28289950 Length = 306 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 19 PPPPPPPPP 27 >06_03_0750 - 24140988-24141037,24141108-24141345,24142158-24142232, 24142345-24142413,24142550-24142581,24143503-24143583, 24143791-24143851,24144135-24144275,24144372-24144563 Length = 312 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 43 PPPPPPPPP 51 >06_03_0743 + 24069752-24070483,24071890-24072345 Length = 395 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 25 PPPPPPPPP 33 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 26 PPPPPPPPP 34 >06_03_0696 + 23617687-23617851,23618838-23619536 Length = 287 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 77 PPPPPPPPP 85 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 78 PPPPPPPPP 86 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 79 PPPPPPPPP 87 >06_03_0526 + 21771519-21771607,21771685-21771810,21771890-21772010, 21772123-21772851,21772954-21773349,21774594-21774665, 21774741-21774803,21775236-21775337 Length = 565 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 310 PPPPPPPPP 318 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 311 PPPPPPPPP 319 >06_03_0214 + 18067945-18068463,18068940-18069839,18069918-18070652 Length = 717 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 203 PPPPPPPPP 211 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 204 PPPPPPPPP 212 >06_02_0257 - 13533689-13533714,13533799-13533925,13534013-13534121, 13534193-13534272,13534758-13534979,13536070-13536318, 13537032-13537484,13539834-13540556 Length = 662 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 63 PPPPPPPPP 71 >06_02_0024 - 10714741-10716241,10716774-10717840 Length = 855 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 2 PPPPPPPPP 10 >06_01_0921 + 7104923-7105396,7106624-7106768,7107078-7107121 Length = 220 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 55 PPPPPPPPP 63 >06_01_0561 - 3983308-3983564,3983652-3983775 Length = 126 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 31 PPPPPPPPP 39 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 32 PPPPPPPPP 40 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 1931 PPPPPPPPP 1939 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 238 PPPPPPPPP 246 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 308 PPPPPPPPP 316 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 309 PPPPPPPPP 317 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 310 PPPPPPPPP 318 >05_07_0031 - 27183252-27183317,27183542-27184282 Length = 268 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 117 PPPPPPPPP 125 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 118 PPPPPPPPP 126 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 119 PPPPPPPPP 127 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 120 PPPPPPPPP 128 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 150 PPPPPPPPP 158 >05_06_0051 - 25190803-25191216,25191301-25191891,25193248-25193317, 25193392-25193443,25195368-25195440,25195557-25195646 Length = 429 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 100 PPPPPPPPP 108 >05_05_0207 + 23272777-23272977,23273831-23275330 Length = 566 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 53 PPPPPPPPP 61 >05_05_0181 + 23033059-23033775 Length = 238 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 166 PPPPPPPPP 174 >05_04_0206 + 19034259-19035462,19036870-19037045,19037752-19037975, 19038133-19038914,19039337-19039494 Length = 847 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 218 PPPPPPPPP 226 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 219 PPPPPPPPP 227 >05_04_0160 - 18624952-18625106,18625411-18625535,18625954-18626087, 18626221-18626298,18626456-18626561,18627739-18627836 Length = 231 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 12 PPPPPPPPP 20 >05_01_0384 + 2997465-2999777,2999960-3000035,3003027-3003102, 3003571-3004442,3004592-3004773,3005206-3005295, 3005388-3005675,3005776-3005997,3006053-3006133, 3006634-3006861 Length = 1475 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 579 PPPPPPPPP 587 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 580 PPPPPPPPP 588 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 581 PPPPPPPPP 589 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 582 PPPPPPPPP 590 >05_01_0380 + 2978256-2979284 Length = 342 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 26 PPPPPPPPP 34 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 27 PPPPPPPPP 35 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 28 PPPPPPPPP 36 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 29 PPPPPPPPP 37 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 30 PPPPPPPPP 38 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 31 PPPPPPPPP 39 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 32 PPPPPPPPP 40 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 33 PPPPPPPPP 41 >05_01_0210 + 1583176-1584177 Length = 333 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 32 PPPPPPPPP 40 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 33 PPPPPPPPP 41 >05_01_0192 + 1394342-1396645 Length = 767 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 3 PPPPPPPPP 11 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 4 PPPPPPPPP 12 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 77 PPPPPPPPP 85 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 78 PPPPPPPPP 86 >04_04_1687 - 35365766-35366356,35367137-35368135 Length = 529 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 10 PPPPPPPPP 18 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 11 PPPPPPPPP 19 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 12 PPPPPPPPP 20 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 13 PPPPPPPPP 21 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 14 PPPPPPPPP 22 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 15 PPPPPPPPP 23 >04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 Length = 389 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 26 PPPPPPPPP 34 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 27 PPPPPPPPP 35 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 28 PPPPPPPPP 36 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 29 PPPPPPPPP 37 >04_04_0887 + 29095087-29096166 Length = 359 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 132 PPPPPPPPP 140 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 133 PPPPPPPPP 141 >04_04_0708 - 27441373-27442611 Length = 412 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 241 PPPPPPPPP 249 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 242 PPPPPPPPP 250 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 243 PPPPPPPPP 251 >04_04_0198 + 23502657-23502900,23505228-23505298,23505690-23505727, 23505905-23507693 Length = 713 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 549 PPPPPPPPP 557 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 550 PPPPPPPPP 558 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 551 PPPPPPPPP 559 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 552 PPPPPPPPP 560 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 365 PPPPPPPPP 373 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 366 PPPPPPPPP 374 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 367 PPPPPPPPP 375 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 368 PPPPPPPPP 376 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 369 PPPPPPPPP 377 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 370 PPPPPPPPP 378 >04_04_0057 + 22410167-22411330 Length = 387 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 181 PPPPPPPPP 189 >04_03_1022 - 21778315-21779007 Length = 230 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 36 PPPPPPPPP 44 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 37 PPPPPPPPP 45 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 38 PPPPPPPPP 46 >04_03_0977 + 21381857-21383757,21384299-21384458,21384669-21384717, 21385117-21385169 Length = 720 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 101 PPPPPPPPP 109 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 102 PPPPPPPPP 110 >04_03_0243 - 13271384-13272865,13272987-13273248,13274617-13276067 Length = 1064 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 160 PPPPPPPPP 168 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 161 PPPPPPPPP 169 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 162 PPPPPPPPP 170 >04_01_0354 - 4646826-4647314 Length = 162 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 93 PPPPPPPPP 101 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 94 PPPPPPPPP 102 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 95 PPPPPPPPP 103 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 96 PPPPPPPPP 104 >04_01_0246 + 3225743-3226473,3226493-3226624,3227580-3227670, 3228617-3229074,3229342-3229864 Length = 644 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 37 PPPPPPPPP 45 >04_01_0197 + 2323790-2324098,2324145-2324774 Length = 312 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 27 PPPPPPPPP 35 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 28 PPPPPPPPP 36 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 29 PPPPPPPPP 37 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 30 PPPPPPPPP 38 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 31 PPPPPPPPP 39 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 32 PPPPPPPPP 40 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 33 PPPPPPPPP 41 >03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 Length = 397 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 355 PPPPPPPPP 363 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 356 PPPPPPPPP 364 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 357 PPPPPPPPP 365 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 358 PPPPPPPPP 366 >03_06_0600 + 34988743-34989407,34990033-34990051 Length = 227 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 152 PPPPPPPPP 160 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 404 PPPPPPPPP 412 >03_06_0411 + 33741903-33742163,33742990-33743168,33743342-33743426, 33743506-33743822,33743983-33744106,33744810-33744902, 33745296-33745364,33745654-33745704,33745705-33745854, 33745904-33746125,33746413-33746568,33746716-33746823, 33746992-33747126,33747209-33747364,33747544-33747664, 33748182-33748267 Length = 770 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 416 PPPPPPPPP 424 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 417 PPPPPPPPP 425 >03_05_1096 - 30364144-30365310,30365825-30365971,30366087-30366393, 30366541-30366849,30367544-30370567,30370640-30372290, 30372373-30373463,30373544-30373646,30373737-30374439, 30374654-30375783,30375913-30376027,30376504-30376695, 30377443-30377616,30378438-30378494,30378581-30378716, 30378842-30378927,30379023-30379092,30379993-30380021, 30380444-30380456,30380762-30381006 Length = 3582 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 21 PPPPPPPPP 29 >03_05_0918 - 28785233-28786613,28786894-28787140,28787773-28788238 Length = 697 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 16 PPPPPPPPP 24 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 17 PPPPPPPPP 25 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 18 PPPPPPPPP 26 >03_05_0732 - 27232299-27232535,27232717-27232746,27233094-27233155, 27233975-27234005,27234618-27234713,27234881-27234969, 27235687-27236263 Length = 373 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 54 PPPPPPPPP 62 >03_04_0042 - 16743440-16743454,16743907-16744002,16744257-16744475, 16744830-16744910,16745092-16745187,16745981-16746045, 16746131-16746217,16746522-16746720 Length = 285 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 17 PPPPPPPPP 25 >03_02_0784 - 11154395-11154888,11155284-11155360,11155447-11155497, 11155599-11155672,11156127-11156215,11156533-11156618, 11157570-11157669,11158540-11158622,11158776-11159194 Length = 490 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 428 PPPPPPPPP 436 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 429 PPPPPPPPP 437 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 430 PPPPPPPPP 438 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 431 PPPPPPPPP 439 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 349 PPPPPPPPP 357 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 350 PPPPPPPPP 358 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 351 PPPPPPPPP 359 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 352 PPPPPPPPP 360 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 353 PPPPPPPPP 361 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 354 PPPPPPPPP 362 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 355 PPPPPPPPP 363 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 356 PPPPPPPPP 364 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 357 PPPPPPPPP 365 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 373 PPPPPPPPP 381 >03_01_0219 + 1731267-1731728,1732148-1732235,1732330-1732417, 1732528-1732573,1732687-1732785,1734363-1734431, 1735706-1736036,1736123-1736256,1736400-1737251 Length = 722 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 11 PPPPPPPPP 19 >02_05_0925 - 32768815-32769654 Length = 279 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 156 PPPPPPPPP 164 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 157 PPPPPPPPP 165 >02_05_0543 + 29872168-29872767,29873089-29873115 Length = 208 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 182 PPPPPPPPP 190 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 183 PPPPPPPPP 191 >02_05_0002 - 24849189-24849825,24850267-24850328 Length = 232 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 218 PPPPPPPPP 226 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 38 PPPPPPPPP 46 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 39 PPPPPPPPP 47 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 40 PPPPPPPPP 48 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 41 PPPPPPPPP 49 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 42 PPPPPPPPP 50 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 43 PPPPPPPPP 51 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 44 PPPPPPPPP 52 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 45 PPPPPPPPP 53 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 46 PPPPPPPPP 54 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 47 PPPPPPPPP 55 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 48 PPPPPPPPP 56 >02_04_0520 - 23628183-23628195,23629354-23630036 Length = 231 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 193 PPPPPPPPP 201 >02_04_0312 - 21942310-21943356 Length = 348 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 178 PPPPPPPPP 186 >02_03_0279 + 17250347-17252098 Length = 583 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 124 PPPPPPPPP 132 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 125 PPPPPPPPP 133 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 126 PPPPPPPPP 134 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 127 PPPPPPPPP 135 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 128 PPPPPPPPP 136 >02_02_0489 + 10869482-10871218 Length = 578 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 10 PPPPPPPPP 18 >02_02_0359 - 9390175-9390416,9390924-9391044,9391069-9391410, 9392400-9392759 Length = 354 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 37 PPPPPPPPP 45 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 38 PPPPPPPPP 46 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 39 PPPPPPPPP 47 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 353 PPPPPPPPP 361 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 354 PPPPPPPPP 362 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 355 PPPPPPPPP 363 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 356 PPPPPPPPP 364 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 357 PPPPPPPPP 365 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 358 PPPPPPPPP 366 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 359 PPPPPPPPP 367 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 360 PPPPPPPPP 368 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 361 PPPPPPPPP 369 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 362 PPPPPPPPP 370 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 363 PPPPPPPPP 371 >02_01_0377 + 2728892-2729187,2729483-2729544,2730516-2730570, 2730784-2730858,2730980-2731054,2731155-2731202, 2731548-2732357,2732450-2732498,2733157-2733266, 2733381-2733488,2733920-2733980 Length = 582 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 12 PPPPPPPPP 20 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 13 PPPPPPPPP 21 >02_01_0016 + 110796-110979,111252-111768,111847-112213 Length = 355 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 216 PPPPPPPPP 224 >01_06_1805 - 39999987-40000169,40000648-40000974,40001724-40002017, 40002112-40002231,40002714-40002776,40003150-40003310, 40003864-40004035 Length = 439 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 27 PPPPPPPPP 35 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 422 PPPPPPPPP 430 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 423 PPPPPPPPP 431 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 424 PPPPPPPPP 432 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 425 PPPPPPPPP 433 >01_06_1321 + 36280691-36281269 Length = 192 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 147 PPPPPPPPP 155 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 148 PPPPPPPPP 156 >01_06_0883 + 32708037-32708558,32708627-32708911,32709661-32709675 Length = 273 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 38 PPPPPPPPP 46 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 39 PPPPPPPPP 47 >01_06_0357 - 28668894-28669238,28669510-28669537,28669578-28669635, 28669836-28669916,28670395-28670526,28670609-28670926, 28672495-28673317 Length = 594 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 2 PPPPPPPPP 10 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 3 PPPPPPPPP 11 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 4 PPPPPPPPP 12 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 5 PPPPPPPPP 13 >01_06_0090 + 26358051-26359157,26359582-26359701,26359968-26360099, 26360194-26360375,26360488-26360602,26362001-26362135, 26362261-26362395 Length = 641 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 290 PPPPPPPPP 298 >01_05_0501 + 22764978-22765896,22766087-22766349,22766613-22766836, 22767419-22767749,22767968-22768372 Length = 713 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 76 PPPPPPPPP 84 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 77 PPPPPPPPP 85 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 78 PPPPPPPPP 86 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 79 PPPPPPPPP 87 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 80 PPPPPPPPP 88 >01_05_0490 + 22672241-22674679 Length = 812 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 607 PPPPPPPPP 615 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 697 PPPPPPPPP 705 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 698 PPPPPPPPP 706 >01_05_0423 + 22032940-22033695 Length = 251 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 28 PPPPPPPPP 36 >01_01_1162 - 9253034-9254229,9254387-9254456,9254473-9254567, 9255344-9255487,9255514-9255622 Length = 537 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 205 PPPPPPPPP 213 >01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827, 8960964-8961054,8961877-8961937,8962172-8962216, 8962318-8962391,8962565-8962637,8963288-8963345, 8963398-8963468,8963801-8963837,8964040-8964128, 8964207-8964263,8964366-8964449,8964529-8964627, 8964765-8964869,8965145-8965216,8965308-8965497, 8965810-8966207 Length = 744 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 82 PPPPPPPPP 90 >01_01_1001 - 7925858-7926559 Length = 233 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 27 PPPPPPPPP 35 >01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593, 7039698-7039768,7040148-7040224,7040380-7040527, 7040973-7041134,7041374-7041694 Length = 597 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 126 PPPPPPPPP 134 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 127 PPPPPPPPP 135 >01_01_0889 + 7008077-7009261 Length = 394 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 278 PPPPPPPPP 286 >01_01_0796 + 6190931-6192745 Length = 604 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 193 PPPPPPPPP 201 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 194 PPPPPPPPP 202 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 195 PPPPPPPPP 203 >01_01_0761 - 5874953-5876803 Length = 616 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 45 PPPPPPPPP 53 >01_01_0369 - 2886060-2886272,2886721-2887434 Length = 308 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 129 PPPPPPPPP 137 >01_01_0046 - 331758-332627 Length = 289 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 21 PPPPPPPPP 29 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 22 PPPPPPPPP 30 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 23 PPPPPPPPP 31 Score = 29.5 bits (63), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1050 PPPPPPPPP 1024 PPPPPPPPP Sbjct: 24 PPPPPPPPP 32 >02_05_0149 + 26290236-26290880 Length = 214 Score = 25.8 bits (54), Expect(2) = 5.9 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +2 Query: 1025 GGGGGGGGG 1051 GGGGGGGGG Sbjct: 131 GGGGGGGGG 139 Score = 21.8 bits (44), Expect(2) = 5.9 Identities = 9/24 (37%), Positives = 10/24 (41%) Frame = +2 Query: 977 FXFXFXXXXXXXXXXXGGGGGGGG 1048 F F + GGGGGG G Sbjct: 91 FGFGYGGSRGEGGGGGGGGGGGSG 114 >05_01_0131 + 888247-888771,889092-889154 Length = 195 Score = 23.8 bits (49), Expect(2) = 5.9 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1050 PPPPPPP 1030 PPPPPPP Sbjct: 133 PPPPPPP 139 Score = 23.8 bits (49), Expect(2) = 5.9 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1047 PPPPPPP 1027 PPPPPPP Sbjct: 133 PPPPPPP 139 Score = 23.8 bits (49), Expect(2) = 5.9 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1047 PPPPPPP 1027 PPPPPPP Sbjct: 160 PPPPPPP 166 Score = 23.8 bits (49), Expect(2) = 5.9 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1044 PPPPPPP 1024 PPPPPPP Sbjct: 160 PPPPPPP 166 >02_02_0029 + 6204557-6204734,6205105-6205207,6205970-6206108 Length = 139 Score = 29.1 bits (62), Expect = 6.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 645 PPPPPPXFX*IXXKKXXGGGGXF 713 PPPPPP F GGGG F Sbjct: 36 PPPPPPFFPPQWAPPVAGGGGPF 58 >02_01_0062 - 448105-448145,448780-448866,449664-449790 Length = 84 Score = 29.1 bits (62), Expect = 6.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 645 PPPPPPXFX*IXXKKXXGGGGXF 713 PPPPPP F GGGG F Sbjct: 19 PPPPPPFFPPQWAPPVPGGGGPF 41 >01_01_0715 - 5542648-5543219,5543352-5543544 Length = 254 Score = 26.6 bits (56), Expect(2) = 7.5 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1047 PPPPPPPP 1024 PPPPPPPP Sbjct: 188 PPPPPPPP 195 Score = 20.6 bits (41), Expect(2) = 7.5 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = -2 Query: 1050 PPPPPPP 1030 P PPPPP Sbjct: 143 PSPPPPP 149 >04_03_0800 - 19820886-19821421,19822476-19822563,19822871-19822888 Length = 213 Score = 23.8 bits (49), Expect(2) = 7.6 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1044 PPPPPPP 1024 PPPPPPP Sbjct: 173 PPPPPPP 179 Score = 23.4 bits (48), Expect(2) = 9.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 1050 PPPPPPPP 1027 P PPPPPP Sbjct: 123 PEPPPPPP 130 Score = 23.4 bits (48), Expect(2) = 7.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 1050 PPPPPPPP 1027 PPPPPP P Sbjct: 125 PPPPPPKP 132 Score = 23.4 bits (48), Expect(2) = 9.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 1047 PPPPPPPP 1024 PPPPPP P Sbjct: 125 PPPPPPKP 132 >01_06_1612 - 38635703-38636215,38638725-38638967 Length = 251 Score = 28.7 bits (61), Expect = 8.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 Query: 706 PPPPXXFXIXIXKXXGGGGGG 644 PPPP + + GGGGGG Sbjct: 115 PPPPTQLMVPVVGYGGGGGGG 135 >01_01_0517 + 3803740-3806106,3806226-3806312,3806397-3807035, 3807118-3807282,3807363-3807657,3807739-3807953, 3808125-3808430,3808539-3808602,3808735-3808974, 3809150-3809253 Length = 1493 Score = 23.4 bits (48), Expect(2) = 8.3 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1025 GGGGGGGG 1048 GGGGGGGG Sbjct: 52 GGGGGGGG 59 Score = 23.4 bits (48), Expect(2) = 8.3 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1028 GGGGGGGG 1051 GGGGGGGG Sbjct: 88 GGGGGGGG 95 >07_01_0389 - 2915191-2915604,2915696-2915752,2915867-2915922, 2916053-2916113,2916243-2916365,2916505-2916537, 2916617-2916709,2916839-2916934,2917025-2917203, 2917344-2917530,2918051-2918184,2918311-2918518, 2918598-2918633,2918785-2919241,2919633-2919736, 2920489-2920569,2920646-2920697,2920837-2920876, 2920991-2921085,2921241-2921383,2921899-2922006, 2922120-2922221,2922302-2922348,2922425-2922554, 2923173-2923304,2923404-2923616,2923709-2923963, 2924053-2924799 Length = 1460 Score = 23.4 bits (48), Expect(2) = 8.3 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 1050 PPPPPPPP 1027 PP PPPPP Sbjct: 9 PPQPPPPP 16 Score = 23.4 bits (48), Expect(2) = 8.3 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 1047 PPPPPPPP 1024 PPPPP PP Sbjct: 12 PPPPPSPP 19 >04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 Length = 1034 Score = 23.4 bits (48), Expect(2) = 8.5 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1025 GGGGGGGG 1048 GGGGGGGG Sbjct: 66 GGGGGGGG 73 Score = 23.4 bits (48), Expect(2) = 8.5 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1028 GGGGGGGG 1051 GGGGGGGG Sbjct: 77 GGGGGGGG 84 >04_04_1641 + 34993807-34994589,34994924-34995022,34995521-34995648, 34996095-34996235,34996456-34996542,34996627-34996780, 34998569-34998628,34999019-34999447,34999524-34999819, 35000278-35000407,35000690-35001187 Length = 934 Score = 23.4 bits (48), Expect(2) = 8.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 1050 PPPPPPPP 1027 P PPPPPP Sbjct: 36 PSPPPPPP 43 Score = 23.4 bits (48), Expect(2) = 8.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 1047 PPPPPPPP 1024 PPPPPP P Sbjct: 38 PPPPPPSP 45 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 23.8 bits (49), Expect(2) = 8.6 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1050 PPPPPPP 1030 PPPPPPP Sbjct: 624 PPPPPPP 630 Score = 23.0 bits (47), Expect(2) = 8.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 1047 PPPPPPPP 1024 PPPPPP P Sbjct: 636 PPPPPPRP 643 >01_01_0720 - 5593311-5595371,5597550-5598027,5598118-5598146 Length = 855 Score = 23.8 bits (49), Expect(2) = 8.7 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = -2 Query: 1047 PPPPPPPPXXXXXXXXXXXKXXKKK 973 P PPPPPP + KK+ Sbjct: 65 PSPPPPPPTKPSRRTLGKARAPKKR 89 Score = 23.0 bits (47), Expect(2) = 8.7 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 1050 PPPPPPPPP 1024 P P PPPPP Sbjct: 63 PSPSPPPPP 71 >10_08_0935 + 21670372-21671396,21672057-21672987 Length = 651 Score = 24.2 bits (50), Expect(2) = 8.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 971 FFFXFXFXXXXXXXXXXXGGGGGGGG 1048 F F F GGGGGGGG Sbjct: 36 FQFQFQLLPKVFQFHMDVGGGGGGGG 61 Score = 22.6 bits (46), Expect(2) = 8.9 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 1025 GGGGGGGGG 1051 GGGGGGG G Sbjct: 55 GGGGGGGEG 63 >07_01_0973 - 8193002-8193261,8193388-8193485,8194117-8194401, 8195559-8195773,8196549-8197058 Length = 455 Score = 23.4 bits (48), Expect(2) = 9.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 1050 PPPPPPPP 1027 P PPPPPP Sbjct: 87 PSPPPPPP 94 Score = 23.4 bits (48), Expect(2) = 9.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 1047 PPPPPPPP 1024 PPPPPP P Sbjct: 89 PPPPPPAP 96 >01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 Length = 448 Score = 23.4 bits (48), Expect(2) = 9.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1025 GGGGGGGG 1048 GGGGGGGG Sbjct: 242 GGGGGGGG 249 Score = 23.4 bits (48), Expect(2) = 9.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1028 GGGGGGGG 1051 GGGGGGGG Sbjct: 285 GGGGGGGG 292 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 23.4 bits (48), Expect(2) = 9.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1025 GGGGGGGG 1048 GGGGGGGG Sbjct: 174 GGGGGGGG 181 Score = 23.4 bits (48), Expect(2) = 9.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1025 GGGGGGGG 1048 GGGGGGGG Sbjct: 187 GGGGGGGG 194 Score = 23.4 bits (48), Expect(2) = 9.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1028 GGGGGGGG 1051 GGGGGGGG Sbjct: 187 GGGGGGGG 194 Score = 23.4 bits (48), Expect(2) = 9.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1025 GGGGGGGG 1048 GGGGGGGG Sbjct: 200 GGGGGGGG 207 Score = 23.4 bits (48), Expect(2) = 9.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1028 GGGGGGGG 1051 GGGGGGGG Sbjct: 200 GGGGGGGG 207 Score = 23.4 bits (48), Expect(2) = 9.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1025 GGGGGGGG 1048 GGGGGGGG Sbjct: 223 GGGGGGGG 230 Score = 23.4 bits (48), Expect(2) = 9.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1028 GGGGGGGG 1051 GGGGGGGG Sbjct: 223 GGGGGGGG 230 Score = 23.4 bits (48), Expect(2) = 9.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1025 GGGGGGGG 1048 GGGGGGGG Sbjct: 237 GGGGGGGG 244 Score = 23.4 bits (48), Expect(2) = 9.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1028 GGGGGGGG 1051 GGGGGGGG Sbjct: 237 GGGGGGGG 244 Score = 23.4 bits (48), Expect(2) = 9.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1025 GGGGGGGG 1048 GGGGGGGG Sbjct: 264 GGGGGGGG 271 Score = 23.4 bits (48), Expect(2) = 9.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1028 GGGGGGGG 1051 GGGGGGGG Sbjct: 264 GGGGGGGG 271 Score = 23.4 bits (48), Expect(2) = 9.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1028 GGGGGGGG 1051 GGGGGGGG Sbjct: 277 GGGGGGGG 284 >12_01_0473 + 3708770-3710026 Length = 418 Score = 23.4 bits (48), Expect(2) = 9.3 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1025 GGGGGGGG 1048 GGGGGGGG Sbjct: 4 GGGGGGGG 11 Score = 23.4 bits (48), Expect(2) = 9.3 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1028 GGGGGGGG 1051 GGGGGGGG Sbjct: 24 GGGGGGGG 31 >01_06_1809 - 40029628-40030539 Length = 303 Score = 23.4 bits (48), Expect(2) = 9.5 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1025 GGGGGGGG 1048 GGGGGGGG Sbjct: 214 GGGGGGGG 221 Score = 23.4 bits (48), Expect(2) = 9.5 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1028 GGGGGGGG 1051 GGGGGGGG Sbjct: 223 GGGGGGGG 230 >02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 Length = 291 Score = 23.4 bits (48), Expect(2) = 9.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 1050 PPPPPPPP 1027 P PPPPPP Sbjct: 133 PSPPPPPP 140 Score = 23.4 bits (48), Expect(2) = 9.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 1047 PPPPPPPP 1024 PPPPPP P Sbjct: 135 PPPPPPAP 142 >03_02_0350 - 7734494-7734952,7735765-7736133 Length = 275 Score = 23.4 bits (48), Expect(2) = 9.6 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1025 GGGGGGGG 1048 GGGGGGGG Sbjct: 12 GGGGGGGG 19 Score = 23.4 bits (48), Expect(2) = 9.6 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 1028 GGGGGGGG 1051 GGGGGGGG Sbjct: 29 GGGGGGGG 36 >02_04_0654 - 24755339-24755408,24755488-24755624,24756243-24756326, 24756929-24756944,24758035-24758405 Length = 225 Score = 23.8 bits (49), Expect(2) = 9.8 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1050 PPPPPPP 1030 PPPPPPP Sbjct: 33 PPPPPPP 39 Score = 23.0 bits (47), Expect(2) = 9.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 1047 PPPPPPPP 1024 P PPPPPP Sbjct: 62 PMPPPPPP 69 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,027,132 Number of Sequences: 37544 Number of extensions: 467271 Number of successful extensions: 29265 Number of sequences better than 10.0: 171 Number of HSP's better than 10.0 without gapping: 3189 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13957 length of database: 14,793,348 effective HSP length: 83 effective length of database: 11,677,196 effective search space used: 3106134136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -