BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_B14 (1033 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 48 2e-05 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 47 2e-05 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 46 5e-05 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 44 2e-04 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 43 5e-04 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 43 5e-04 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 5e-04 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 42 8e-04 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 41 0.002 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.030 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 37 0.030 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 36 0.040 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.053 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 36 0.070 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 36 0.070 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 34 0.16 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 0.22 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 33 0.38 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.50 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 33 0.50 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.87 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 32 0.87 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 29 1.0 SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) 31 1.1 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 31 2.0 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 30 2.6 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 30 3.5 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 29 4.6 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 29 4.6 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 29 4.6 SB_17878| Best HMM Match : Drf_FH1 (HMM E-Value=0.022) 29 4.6 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 29 6.1 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 29 8.1 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 29 8.1 SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) 26 8.6 SB_49263| Best HMM Match : Surp (HMM E-Value=1e-28) 24 8.9 SB_40783| Best HMM Match : MH2 (HMM E-Value=0) 26 9.1 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 47.6 bits (108), Expect = 2e-05 Identities = 29/82 (35%), Positives = 29/82 (35%), Gaps = 6/82 (7%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP----PPPXXXXXXXXPXXXXGGXX 677 GG PPPP GG PP PPPP PPP P G Sbjct: 916 GGSVPPPPPPPGGNAPL---PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPP 972 Query: 678 XXPPP--XPPPXXKKXXPPPPP 737 PPP PP PPPPP Sbjct: 973 LPPPPGGSAPPPPPPPPPPPPP 994 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPP 800 PPP PPP PPPPP + + GG PP Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPP 958 Score = 36.3 bits (80), Expect = 0.040 Identities = 27/87 (31%), Positives = 28/87 (32%), Gaps = 3/87 (3%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGG--- 776 PPPPPPP GG PPP PP PPPP + GG Sbjct: 920 PPPPPPP-------------GGNAPLPPP--PPGGSAPSQPPPPGGNAPPPPPPPGGSAP 964 Query: 777 XXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PP P PPP P Sbjct: 965 PPGGGAPPLPPPPGGSAPPPPPPPPPP 991 Score = 35.1 bits (77), Expect = 0.093 Identities = 26/81 (32%), Positives = 26/81 (32%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXX 785 PPPPP P GG P PPP PPPPP S GG Sbjct: 922 PPPPPG----GNAPLPPPPPGG---SAPSQPPPPGGNAPPPPPPPGGS--APPPGGGAPP 972 Query: 786 XXXPPXXXXXFXFXXXPXPPP 848 PP P PPP Sbjct: 973 LPPPPGGSAPPPPPPPPPPPP 993 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 664 GGGGXXXPPPXXPXXKKKXPPPPPP 738 GGG PPP PPPPPP Sbjct: 967 GGGAPPLPPPPGGSAPPPPPPPPPP 991 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 652 PXXXGGGGXXXPPPXXPXXKKKXPPPPPP 738 P GG PPP PPPPPP Sbjct: 964 PPPGGGAPPLPPPPGGSAPPPPPPPPPPP 992 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 47.6 bits (108), Expect = 2e-05 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP PPPPPPP P PPP PPP PPPPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 46.8 bits (106), Expect = 3e-05 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPPP P PPP PPP PPPPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 46.8 bits (106), Expect = 3e-05 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPPP P PPP PPP PPPPP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 44.4 bits (100), Expect = 2e-04 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPPP P P P PPP PPPPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 44.4 bits (100), Expect = 2e-04 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPPP P PP PPP PPPPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP PPPPPP P PPP PPP PPPPP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP PPPP PP P PPP PPP PPPPP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP PPP PPP P PPP PPP PPPPP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 43.6 bits (98), Expect = 3e-04 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPPP P PP PPP PPPPP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 43.6 bits (98), Expect = 3e-04 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP PPPP P PPP PPP PPPPP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 41.9 bits (94), Expect = 8e-04 Identities = 23/71 (32%), Positives = 23/71 (32%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP PPPP PP P PPP PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPP---SPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Query: 702 PXXKKXXPPPP 734 P PPPP Sbjct: 422 PPPPPPPPPPP 432 Score = 41.9 bits (94), Expect = 8e-04 Identities = 22/70 (31%), Positives = 23/70 (32%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP PPPPPPP P PPP PP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Query: 702 PXXKKXXPPP 731 P + PP Sbjct: 432 PALRLACAPP 441 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P PPPPP P PPP PP PPPPP Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/71 (30%), Positives = 24/71 (33%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP + PPPPPPP P PPP PP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQP--PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Query: 702 PXXKKXXPPPP 734 P + PP Sbjct: 431 PPALRLACAPP 441 Score = 33.5 bits (73), Expect = 0.28 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +3 Query: 669 GXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPP 848 G PPP PPP PPPPP PP P PPP Sbjct: 360 GINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP----PPPPPPPP 415 Query: 849 XXP 857 P Sbjct: 416 PPP 418 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 408 PPPPPPPPPPPAPPPPPP 425 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 409 PPPPPPPPPPAPPPPPPP 426 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 410 PPPPPPPPPAPPPPPPPP 427 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 411 PPPPPPPPAPPPPPPPPP 428 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 412 PPPPPPPAPPPPPPPPPP 429 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 413 PPPPPPAPPPPPPPPPPP 430 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 415 PPPPAPPPPPPPPPPPPP 432 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPP P Sbjct: 403 PPPPPPPPPPPPPPPPAP 420 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPP PP Sbjct: 404 PPPPPPPPPPPPPPPAPP 421 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PP PPP Sbjct: 405 PPPPPPPPPPPPPPAPPP 422 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P P PPPP Sbjct: 406 PPPPPPPPPPPPPAPPPP 423 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPP Sbjct: 407 PPPPPPPPPPPPAPPPPP 424 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 47.2 bits (107), Expect = 2e-05 Identities = 27/75 (36%), Positives = 29/75 (38%), Gaps = 3/75 (4%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXG---GXXXXPPP 692 PPPP G G PP + PPPPPPP P G PPP Sbjct: 338 PPPPSRGAPPPPSMGMAPP---PVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPP 394 Query: 693 XPPPXXKKXXPPPPP 737 PPP + PPP P Sbjct: 395 PPPPG--RGAPPPGP 407 Score = 43.6 bits (98), Expect = 3e-04 Identities = 29/87 (33%), Positives = 29/87 (33%), Gaps = 13/87 (14%) Frame = +3 Query: 513 GGXPPPPXXGGGXXX-FXGXXPPXKKXIFXXXPPPPPP------PXXXXXXXXPXXXXG- 668 G PPPP G G PP PPPPPP P P G Sbjct: 294 GAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGM 353 Query: 669 -----GXXXXPPPXPPPXXKKXXPPPP 734 G PPP PPP PPPP Sbjct: 354 APPPVGGAAPPPPPPPPVGGPPPPPPP 380 Score = 38.3 bits (85), Expect = 0.010 Identities = 28/83 (33%), Positives = 28/83 (33%), Gaps = 11/83 (13%) Frame = +3 Query: 522 PPPPXXGGG-XXXFXGXXPPXKKXIFXXXPPP------PPPPXXXXXXXXPXXXXGGXXX 680 PPPP G G PP PPP PPPP P G Sbjct: 288 PPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRG--A 345 Query: 681 XPPP----XPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 346 PPPPSMGMAPPPVGGAAPPPPPP 368 Score = 36.3 bits (80), Expect = 0.040 Identities = 30/103 (29%), Positives = 31/103 (30%), Gaps = 8/103 (7%) Frame = +3 Query: 564 GXXPPXKKXIFXXXPPP----PPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPP 731 G PP PPP PPPP P G PPP PP + PPP Sbjct: 284 GIQPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTA--PPPPPPSRSSQRPPPP 341 Query: 732 ----PPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPP 848 PP GG PP P PPP Sbjct: 342 SRGAPPPPSMGMAPPPVGGAAPPPPPPPPVG----GPPPPPPP 380 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 363 PPPPPPPPVGGPPPPPPP 380 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 46.0 bits (104), Expect = 5e-05 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXX--GGXXXXPPPXPPPXXKKXXPPPPP 737 PP PPPPPPP P G PPP PPP PPPPP Sbjct: 702 PPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPP 758 Score = 37.5 bits (83), Expect = 0.017 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPP-PXXXXXXXXPXXXXGGXXXXPPPXP 698 PPPP G PP PPPP P P P G PPP P Sbjct: 699 PPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPP 758 Query: 699 P 701 P Sbjct: 759 P 759 Score = 35.9 bits (79), Expect = 0.053 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXG---GXXXXPPPXPPPXXK-KXXPPPPP 737 PPPPPPP P G PPP P P PPPPP Sbjct: 697 PPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPP 744 Score = 33.9 bits (74), Expect = 0.21 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 10/54 (18%) Frame = +3 Query: 606 PPPPPP----------PXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPP P G PPP PPP PPPPP Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPP 730 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 742 PPPPPPPGCAGLPPPPPP 759 Score = 28.7 bits (61), Expect = 8.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P P PPPP Sbjct: 698 PPPPPPLLSGTLPMPPPP 715 Score = 28.7 bits (61), Expect = 8.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPP P Sbjct: 715 PPPPPPGCAGLPPPPPSP 732 Score = 28.7 bits (61), Expect = 8.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 652 PXXXGGGGXXXPPPXXPXXKKKXPPPPPP 738 P G G PPP PPPPPP Sbjct: 717 PPPPGCAGLPPPPPSPQPGCAGLPPPPPP 745 Score = 28.7 bits (61), Expect = 8.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PP P P PPPPPP Sbjct: 729 PPSPQPGCAGLPPPPPPP 746 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPP P G PPP PPP PPPPP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPP--PXPPPXXKKXXPPPPP 737 PPPPP P GG PP P PPP PPPPP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 37.9 bits (84), Expect = 0.013 Identities = 26/66 (39%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Frame = +3 Query: 510 GGGXP-PPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXP 686 GGG P PPP G PP PPPPPPP P GG P Sbjct: 286 GGGAPVPPPPPADGSAPAPPPPPPP-----GGAPPPPPPPPP------PPPGDGGA---P 331 Query: 687 PPXPPP 704 PP PPP Sbjct: 332 PPPPPP 337 Score = 33.1 bits (72), Expect = 0.38 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 652 PXXXGGGGXXXPPPXXPXXKKKXPPPPPP 738 P GGG PPP PPPPPP Sbjct: 281 PDIVTGGGAPVPPPPPADGSAPAPPPPPP 309 Score = 32.7 bits (71), Expect = 0.50 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 668 GXXXXXPPPPXPXXKKXXPPPPPP 739 G PPPP P PPPPPP Sbjct: 299 GSAPAPPPPPPPGGAPPPPPPPPP 322 Score = 32.3 bits (70), Expect = 0.66 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 665 GGXXXXXPPPPXPXXKKXXPPPPPP 739 G PPPP P PPPPPP Sbjct: 312 GAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 31.9 bits (69), Expect = 0.87 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 664 GGGGXXXPPPXXPXXKKKXPPPPPP 738 GGG PPP PPPPPP Sbjct: 286 GGGAPVPPPPPADGSAPAPPPPPPP 310 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 665 GGXXXXXPPPPXPXXKKXXPPPPPP 739 GG PPPP P PPPPP Sbjct: 311 GGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 577 GGXXPXKXXXPPPXXGGGGXPPP 509 GG P PPP G GG PPP Sbjct: 311 GGAPPPPPPPPPPPPGDGGAPPP 333 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 320 PPPPPPGDGGAPPPPPPP 337 Score = 31.1 bits (67), Expect = 1.5 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +3 Query: 651 PXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXX 830 P GG PPP PP PPPPP GG PP Sbjct: 281 PDIVTGGGAPVPPP-PPADGSAPAPPPPP---------PPGGAPPPPPPPPPPPPGDGGA 330 Query: 831 XPXPPP 848 P PPP Sbjct: 331 PPPPPP 336 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 652 PXXXGGGGXXXPPPXXPXXKKKXPPPPPP 738 P G PPP P PPPPPP Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPPP 321 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 42.7 bits (96), Expect = 5e-04 Identities = 27/81 (33%), Positives = 29/81 (35%), Gaps = 9/81 (11%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPX--KKXIFXXXPPP------PPPPXXXXXXXXPXXXXGGXX 677 PPPP G F PP + PPP PPPP P G Sbjct: 281 PPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIA 340 Query: 678 XXPPP-XPPPXXKKXXPPPPP 737 PPP PP + PPPPP Sbjct: 341 PPPPPISKPPTSTRSAPPPPP 361 Score = 41.9 bits (94), Expect = 8e-04 Identities = 33/118 (27%), Positives = 33/118 (27%), Gaps = 5/118 (4%) Frame = +3 Query: 510 GGGXPPPPXXG---GGXXXFXGXXPPXKKXIFXXXPPPPP--PPXXXXXXXXPXXXXGGX 674 G PPPP G GG PP K PPPP PP P Sbjct: 246 GENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPS-- 303 Query: 675 XXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPP 848 P PPP PPPP G PP P PPP Sbjct: 304 RDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPP 361 Score = 39.1 bits (87), Expect = 0.006 Identities = 25/72 (34%), Positives = 25/72 (34%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP G PP K PPPPP GG PP P Sbjct: 331 PPPPLRG----QIAPPPPPISKPPTSTRSAPPPPPGRAPQPL------GGPPPPPPGRRP 380 Query: 702 PXXKKXXPPPPP 737 P K PPPPP Sbjct: 381 PSGKINPPPPPP 392 Score = 37.9 bits (84), Expect = 0.013 Identities = 24/74 (32%), Positives = 25/74 (33%), Gaps = 2/74 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP G G PP P P PPP G PP P Sbjct: 215 PPPPPPGRGPSQRSLAPPPTGSS----RPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAP 270 Query: 702 PXXKK--XXPPPPP 737 P K+ PPPPP Sbjct: 271 PPPKRGSSNPPPPP 284 Score = 35.5 bits (78), Expect = 0.070 Identities = 27/84 (32%), Positives = 28/84 (33%), Gaps = 10/84 (11%) Frame = +3 Query: 516 GXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPP----PPXXXXXXXXPXXXXGGXXXX 683 G PPPP GG KK PPPPP PP Sbjct: 145 GAPPPPDRGGQLA---------KKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPP 195 Query: 684 PPPX------PPPXXKKXXPPPPP 737 PPP PPP + PPPPP Sbjct: 196 PPPHSRHGSAPPPPERSSGPPPPP 219 Score = 32.7 bits (71), Expect = 0.50 Identities = 21/73 (28%), Positives = 22/73 (30%) Frame = +3 Query: 513 GGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPP 692 G PPPP G G P PPPPP P PPP Sbjct: 163 GSFPPPPPMGKPPPP-SGNKPTFGNSRTSTNGPPPPP-HSRHGSAPPPPERSSGPPPPPP 220 Query: 693 XPPPXXKKXXPPP 731 P + PPP Sbjct: 221 GRGPSQRSLAPPP 233 Score = 29.5 bits (63), Expect = 4.6 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +1 Query: 670 GGXXXPPPXX--PXXKKKXPPPPPP 738 GG PPP P K PPPPPP Sbjct: 369 GGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +3 Query: 525 PPPXXGGGXXXFXGXXPPX---KKXIFXXXPPPPPPP 626 PPP G G PP + PPPPPPP Sbjct: 357 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 2/20 (10%) Frame = +2 Query: 686 PPPPX--PXXKKXXPPPPPP 739 PPPP P K PPPPPP Sbjct: 373 PPPPGRRPPSGKINPPPPPP 392 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 42.7 bits (96), Expect = 5e-04 Identities = 27/81 (33%), Positives = 29/81 (35%), Gaps = 9/81 (11%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPX--KKXIFXXXPPP------PPPPXXXXXXXXPXXXXGGXX 677 PPPP G F PP + PPP PPPP P G Sbjct: 193 PPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIA 252 Query: 678 XXPPP-XPPPXXKKXXPPPPP 737 PPP PP + PPPPP Sbjct: 253 PPPPPISKPPTSTRSAPPPPP 273 Score = 41.9 bits (94), Expect = 8e-04 Identities = 33/118 (27%), Positives = 33/118 (27%), Gaps = 5/118 (4%) Frame = +3 Query: 510 GGGXPPPPXXG---GGXXXFXGXXPPXKKXIFXXXPPPPP--PPXXXXXXXXPXXXXGGX 674 G PPPP G GG PP K PPPP PP P Sbjct: 158 GENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPS-- 215 Query: 675 XXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPP 848 P PPP PPPP G PP P PPP Sbjct: 216 RDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPP 273 Score = 39.1 bits (87), Expect = 0.006 Identities = 25/72 (34%), Positives = 25/72 (34%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP G PP K PPPPP GG PP P Sbjct: 243 PPPPLRG----QIAPPPPPISKPPTSTRSAPPPPPGRAPQPL------GGPPPPPPGRRP 292 Query: 702 PXXKKXXPPPPP 737 P K PPPPP Sbjct: 293 PSGKINPPPPPP 304 Score = 37.9 bits (84), Expect = 0.013 Identities = 24/74 (32%), Positives = 25/74 (33%), Gaps = 2/74 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP G G PP P P PPP G PP P Sbjct: 127 PPPPPPGRGPSQRSLAPPPTGSS----RPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAP 182 Query: 702 PXXKK--XXPPPPP 737 P K+ PPPPP Sbjct: 183 PPPKRGSSNPPPPP 196 Score = 35.5 bits (78), Expect = 0.070 Identities = 27/84 (32%), Positives = 28/84 (33%), Gaps = 10/84 (11%) Frame = +3 Query: 516 GXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPP----PPXXXXXXXXPXXXXGGXXXX 683 G PPPP GG KK PPPPP PP Sbjct: 57 GAPPPPDRGGQLA---------KKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPP 107 Query: 684 PPPX------PPPXXKKXXPPPPP 737 PPP PPP + PPPPP Sbjct: 108 PPPHSRHGSAPPPPERSSGPPPPP 131 Score = 32.7 bits (71), Expect = 0.50 Identities = 21/73 (28%), Positives = 22/73 (30%) Frame = +3 Query: 513 GGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPP 692 G PPPP G G P PPPPP P PPP Sbjct: 75 GSFPPPPPMGKPPPP-SGNKPTFGNSRTSTNGPPPPP-HSRHGSAPPPPERSSGPPPPPP 132 Query: 693 XPPPXXKKXXPPP 731 P + PPP Sbjct: 133 GRGPSQRSLAPPP 145 Score = 29.5 bits (63), Expect = 4.6 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +1 Query: 670 GGXXXPPPXX-PXXKKKXPPPPPP 738 GG PPP P K PPPPPP Sbjct: 281 GGPPPPPPGRRPPSGKINPPPPPP 304 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +3 Query: 525 PPPXXGGGXXXFXGXXPPX---KKXIFXXXPPPPPPP 626 PPP G G PP + PPPPPPP Sbjct: 269 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 305 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 42.7 bits (96), Expect = 5e-04 Identities = 33/109 (30%), Positives = 33/109 (30%), Gaps = 13/109 (11%) Frame = +3 Query: 513 GGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP-------PPPPXXXXXXXXPXXXXGG 671 GG PPPP G G G PP PPP PPPP P G Sbjct: 500 GGGPPPPGAGQG-----GGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQ 554 Query: 672 XXXXPPP------XPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPP 800 PPP PPP PPPP G PP Sbjct: 555 GWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPP 603 Score = 40.7 bits (91), Expect = 0.002 Identities = 32/109 (29%), Positives = 33/109 (30%), Gaps = 13/109 (11%) Frame = +3 Query: 513 GGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP-------PPPPXXXXXXXXPXXXXGG 671 GG PPPP G G PP PPP PPPP P G Sbjct: 511 GGGPPPPGAGQGWGQ-----PPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQ 565 Query: 672 XXXXPPPX------PPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPP 800 PPP PPP + PPPP G PP Sbjct: 566 GGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAGQGWGLPPP 614 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 41.9 bits (94), Expect = 8e-04 Identities = 27/78 (34%), Positives = 27/78 (34%), Gaps = 3/78 (3%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPP---PPPPPXXXXXXXXPXXXXGGXXX 680 GGG PPP PP PP PPPPP P G Sbjct: 341 GGGVNPPPPPTNNPPS----PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNG--- 393 Query: 681 XPPPXPPPXXKKXXPPPP 734 PPP PPP PPPP Sbjct: 394 -PPPPPPPTNGPPPPPPP 410 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P K PPPPPP Sbjct: 365 PPPPPPTNKP--PPPPPP 380 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 6/31 (19%) Frame = +1 Query: 664 GGGGXXXPPPXX------PXXKKKXPPPPPP 738 GGGG PPP P PPPPPP Sbjct: 340 GGGGVNPPPPPTNNPPSPPPPTNNTPPPPPP 370 Score = 29.9 bits (64), Expect = 3.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP P PPPPPP Sbjct: 374 PPPPPPPTNGPPPPPPP 390 Score = 29.9 bits (64), Expect = 3.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP P PPPPPP Sbjct: 384 PPPPPPPTNGPPPPPPP 400 Score = 29.9 bits (64), Expect = 3.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP P PPPPPP Sbjct: 394 PPPPPPPTNGPPPPPPP 410 Score = 28.7 bits (61), Expect = 8.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 666 GGXXXXPPPXPPPXXKKXXPPPPP 737 GG P P PPP PP PP Sbjct: 69 GGAPSTPAPPPPPPPPSSGPPLPP 92 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 41.9 bits (94), Expect = 8e-04 Identities = 23/72 (31%), Positives = 23/72 (31%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP G PP PPPPPP P PP P Sbjct: 139 PPPPPIAPATG---GPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGP 195 Query: 702 PXXKKXXPPPPP 737 P PPPPP Sbjct: 196 PPPPPPPPPPPP 207 Score = 41.5 bits (93), Expect = 0.001 Identities = 27/109 (24%), Positives = 28/109 (25%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP PPPPPP P PPP PP Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPP 169 Query: 702 PXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPP 848 P P + GG PP PPP Sbjct: 170 IAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPP 218 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/83 (27%), Positives = 23/83 (27%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXX 788 PPPPP P PPP PP PPPPP Sbjct: 126 PPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAA 185 Query: 789 XXPPXXXXXFXFXXXPXPPPXXP 857 PP P PPP P Sbjct: 186 ASPPPPSGGPPPPPPPPPPPPPP 208 Score = 39.5 bits (88), Expect = 0.004 Identities = 23/75 (30%), Positives = 24/75 (32%) Frame = +3 Query: 513 GGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPP 692 GG PPPP G PP P P P P PPP Sbjct: 149 GGPPPPPPIAPAT----GGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPP 204 Query: 693 XPPPXXKKXXPPPPP 737 PPP + PPPP Sbjct: 205 PPPPPILELAAPPPP 219 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/55 (29%), Positives = 18/55 (32%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P + + PPPP P P PP PPP PPPP Sbjct: 100 PMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPP 154 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPP P PPP PP PPPPP Sbjct: 25 PPPPPPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPPP 68 Score = 33.9 bits (74), Expect = 0.21 Identities = 21/63 (33%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXX--GGXXXXPPPX 695 PPPP F P + PPPPPPP P G PPP Sbjct: 25 PPPPPP---TRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPP 81 Query: 696 PPP 704 PPP Sbjct: 82 PPP 84 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP PPPPPP Sbjct: 52 PPPPPRFYDNDIPPPPPP 69 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPPP P GG PPP PPP PPPPP Sbjct: 661 PPPPPPP--------PGGQAGG---APPPPPPPLPGGAAPPPPP 693 Score = 36.3 bits (80), Expect = 0.040 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +3 Query: 513 GGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGG 671 G PPPP GG G PP + PPPPPP P GG Sbjct: 659 GPPPPPPPPPGGQAG--GAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPPGFGG 709 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PP PPPPPPP P GG PPP PP Sbjct: 665 PPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGG--GAPPPPPP 705 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPP P G PP PPP PPPPP Sbjct: 664 PPPPPGGQAGGAPPPPPPPLPG--GAAPPPPPPIGGGAPPPPPP 705 Score = 32.7 bits (71), Expect = 0.50 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 652 PXXXGGGGXXXPPPXXPXXKKKXPPPPPP 738 P G G PPP P PPPPPP Sbjct: 666 PPPGGQAGGAPPPPPPPLPGGAAPPPPPP 694 Score = 29.9 bits (64), Expect = 3.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P + PPPPP Sbjct: 663 PPPPPPGGQAGGAPPPPP 680 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 652 PXXXGGGGXXXPPPXXPXXKKKXPPPPPP 738 P GG PPP P PPPPP Sbjct: 665 PPPPGGQAGGAPPPPPPPLPGGAAPPPPP 693 Score = 28.7 bits (61), Expect = 8.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP P PPPPPP Sbjct: 689 PPPPPPIGGGAPPPPPP 705 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 40.3 bits (90), Expect = 0.002 Identities = 28/92 (30%), Positives = 30/92 (32%), Gaps = 16/92 (17%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXX------PPXKKXIFXXXPPPPPPPXXXXXXXX------PXXXX 665 PPPP GGG PP + P PPPPP P Sbjct: 689 PPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPPLGRDSAAVFMLTWTPLTNT 748 Query: 666 GGXXXXPPPXPPPXXK----KXXPPPPPXXXS 749 PPP PPP + PPPPP S Sbjct: 749 SSAANVPPPPPPPAVPGEGARPPPPPPPPAVS 780 Score = 33.1 bits (72), Expect = 0.38 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPP PP P G PP PP PPPP Sbjct: 684 PPPPAPPPPPIGGGDPTIWVSG---GPPLSAPPLSSTLGPPPP 723 Score = 29.9 bits (64), Expect = 3.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +1 Query: 685 PPPXXPXXKKKXPPPPPP 738 PPP P + PPPPPP Sbjct: 759 PPPAVPGEGARPPPPPPP 776 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP + PPPPPP Sbjct: 758 PPPPAVPGEGARPPPPPP 775 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPP P G PPP P P PPPPP Sbjct: 280 PPPPPP--LTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPP 320 Score = 31.9 bits (69), Expect = 0.87 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 304 PPPPLPAGVPAPPPPPPP 321 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 6/41 (14%) Frame = +3 Query: 522 PPPPXXGG------GXXXFXGXXPPXKKXIFXXXPPPPPPP 626 PPPP GG G PP PPPPPPP Sbjct: 282 PPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 513 GGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPP 623 GG PPP GG PP + PPPPPP Sbjct: 288 GGMLPPPF--GGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 665 GGXXXXXPPPPXPXXKKXXPPPPPP 739 GG PPPP PPPPPP Sbjct: 296 GGHPAAAPPPPPLPAGVPAPPPPPP 320 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 652 PXXXGGGGXXXPPPXXPXXKKKXPPPPPPXXXLXXXK 762 P GG PPP PPPPPP L K Sbjct: 292 PPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGGPK 328 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 37.9 bits (84), Expect = 0.013 Identities = 25/72 (34%), Positives = 26/72 (36%), Gaps = 2/72 (2%) Frame = +3 Query: 528 PPXXGGGXXXFXGXXPPXKKX--IFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PP G G G PP K I PPP PP P G PPP P Sbjct: 376 PPGAGNGPG---GPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFP 432 Query: 702 PXXKKXXPPPPP 737 + PPPPP Sbjct: 433 QF--QPPPPPPP 442 Score = 30.3 bits (65), Expect = 2.6 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP P + PPPPPP Sbjct: 425 PPPPPGFPQFQPPPPPP 441 Score = 28.7 bits (61), Expect = 8.1 Identities = 24/87 (27%), Positives = 25/87 (28%), Gaps = 11/87 (12%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXK-----KXIFXXXPPPP------PPPXXXXXXXXPX 656 G G PPP F PP + K I PPPP PP P Sbjct: 302 GVGEAPPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPK 361 Query: 657 XXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP PP PPP Sbjct: 362 PLMSTPVQRPPGMRPPGAGNGPGGPPP 388 Score = 28.7 bits (61), Expect = 8.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP + PPPPPP Sbjct: 425 PPPPPGFPQFQPPPPPPP 442 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 37.1 bits (82), Expect = 0.023 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPP P PPP PP PPPPP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPP---AAPPPPPP 90 Score = 33.9 bits (74), Expect = 0.21 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 4/48 (8%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXG----GXXXXPPPXPPPXXKKXXPPPPP 737 PPPPP P P PP PPP PPPPP Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPP 98 Score = 33.5 bits (73), Expect = 0.28 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPP--PXPPPXXKKXXPPPPP 737 P PPPP P PP P PPP + P PPP Sbjct: 62 PAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 Score = 29.5 bits (63), Expect = 4.6 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP PPPP P P P P PP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPA---APPPPAAPPAAPPPPPP---------LPAPPPP 97 Query: 702 PXXKKXXPPPPP 737 P PPP P Sbjct: 98 PAQPAPQPPPAP 109 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 36.7 bits (81), Expect = 0.030 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPP PP P PPP PP PPPP Sbjct: 149 PPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPP 191 Score = 36.7 bits (81), Expect = 0.030 Identities = 19/56 (33%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXP--PPXXKKXXPPPP 734 PP ++ PPP PPP P PPP P PP PPPP Sbjct: 154 PPYPPPLYP--PPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPP 207 Score = 36.3 bits (80), Expect = 0.040 Identities = 21/71 (29%), Positives = 22/71 (30%) Frame = +3 Query: 525 PPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPP 704 PPP PP + P PP PP P PPP PPP Sbjct: 125 PPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPP--NAPYPPPPYPPP 182 Query: 705 XXKKXXPPPPP 737 PPP P Sbjct: 183 PNPPYPPPPNP 193 Score = 35.1 bits (77), Expect = 0.093 Identities = 22/86 (25%), Positives = 23/86 (26%), Gaps = 2/86 (2%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXP--PPXXKKXXPPPPPXXXSXXKXXXXGGX 779 PP PPPP P PPP P PP PP P Sbjct: 100 PPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPP 159 Query: 780 XXXXXPPXXXXXFXFXXXPXPPPXXP 857 P + P PPP P Sbjct: 160 LYPPPPNPPPPNAPYPPPPYPPPPNP 185 Score = 35.1 bits (77), Expect = 0.093 Identities = 23/85 (27%), Positives = 23/85 (27%), Gaps = 2/85 (2%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXP--PPXXKKXXPPPPPXXXSXXKXXXXGGXX 782 PPPP P P PPP P PP P PPP Sbjct: 125 PPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPN 184 Query: 783 XXXXPPXXXXXFXFXXXPXPPPXXP 857 PP P PPP P Sbjct: 185 PPYPPPPNPPYPPPPNAPNPPPPNP 209 Score = 35.1 bits (77), Expect = 0.093 Identities = 23/75 (30%), Positives = 25/75 (33%), Gaps = 3/75 (4%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXX-PPXKKXIFXXXPPPP-PPPXXXXXXXXPXXXXGGXXXXP-PP 692 PPPP + PP + P PP PPP P P PP Sbjct: 162 PPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPP 221 Query: 693 XPPPXXKKXXPPPPP 737 PPP P PPP Sbjct: 222 YPPPPNAPNPPYPPP 236 Score = 34.7 bits (76), Expect = 0.12 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 2/59 (3%) Frame = +3 Query: 564 GXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXP--PPXXKKXXPPPP 734 G PP F PP PPPP P PPP PP PPPP Sbjct: 81 GGHPPTN---FSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPP 136 Score = 34.7 bits (76), Expect = 0.12 Identities = 23/76 (30%), Positives = 25/76 (32%), Gaps = 4/76 (5%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXX-PPXKKXIFXXXPPPPPP-PXXXXXXXXPXXXXGGXXXXPPPX 695 PPPP + PP + P PPPP P P PPP Sbjct: 149 PPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPN 208 Query: 696 P--PPXXKKXXPPPPP 737 P PP PP PP Sbjct: 209 PPYPPPPNAPNPPYPP 224 Score = 33.5 bits (73), Expect = 0.28 Identities = 19/70 (27%), Positives = 20/70 (28%) Frame = +3 Query: 525 PPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPP 704 PPP PP + P P PP P PPP PP Sbjct: 109 PPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPP 168 Query: 705 XXKKXXPPPP 734 PPPP Sbjct: 169 PPNAPYPPPP 178 Score = 33.1 bits (72), Expect = 0.38 Identities = 22/84 (26%), Positives = 22/84 (26%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXX 785 PPPP PP P PPP PP P PP Sbjct: 162 PPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPP 221 Query: 786 XXXPPXXXXXFXFXXXPXPPPXXP 857 PP P PPP P Sbjct: 222 YPPPPNA------PNPPYPPPPNP 239 Score = 32.7 bits (71), Expect = 0.50 Identities = 21/83 (25%), Positives = 23/83 (27%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXX 788 PP PPP P PPP P PP PP + Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPP 151 Query: 789 XXPPXXXXXFXFXXXPXPPPXXP 857 PP + P PPP P Sbjct: 152 PNPPYPPPLYPPPPNP-PPPNAP 173 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 36.7 bits (81), Expect = 0.030 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 6/61 (9%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXX------PXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PP PPPPPPP P PPP P P + PPPP Sbjct: 269 PPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPP 328 Query: 735 P 737 P Sbjct: 329 P 329 Score = 32.7 bits (71), Expect = 0.50 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 311 PPPPPPEPTSELPPPPPP 328 Score = 32.3 bits (70), Expect = 0.66 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPP 626 PPPP G G PP PPPPP P Sbjct: 284 PPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEP 318 Score = 30.3 bits (65), Expect = 2.6 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP + PPPPPP Sbjct: 312 PPPPPEPTSELPPPPPPP 329 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 36.3 bits (80), Expect = 0.040 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPP PPP P PPP PP P PPP Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 Score = 32.7 bits (71), Expect = 0.50 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 217 PPPPPPSPSPPRPPPPPP 234 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 204 PPPPPPRPPPSPPPPPPP 221 Score = 29.5 bits (63), Expect = 4.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPPXXXS 749 PPP PP PPPPP S Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPS 225 Score = 29.5 bits (63), Expect = 4.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPPXXXS 749 PPP PPP PPPP S Sbjct: 215 PPPPPPPPSPSPPRPPPPPPPS 236 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 35.9 bits (79), Expect = 0.053 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPPPP P PPP PP + P P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 33.1 bits (72), Expect = 0.38 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P + PPPPPP Sbjct: 694 PPPPPPPPQPSTPPPPPP 711 Score = 32.7 bits (71), Expect = 0.50 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPP PPP PPP + PPPPP Sbjct: 683 PPPPPP---------------PPPPPPPPPPPPPQPSTPPPPP 710 Score = 32.7 bits (71), Expect = 0.50 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPS 704 Score = 29.9 bits (64), Expect = 3.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P + PPPPP Sbjct: 693 PPPPPPPPPQPSTPPPPP 710 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 35.5 bits (78), Expect = 0.070 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPPP PPP PPP PPPPP Sbjct: 464 PPPPPPPPP-------------PPPPPPPPPPPPPPPFPPPPPP 494 Score = 33.1 bits (72), Expect = 0.38 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 669 GXXXXPPPXPPPXXKKXXPPPPP 737 G PPP PPP PPPPP Sbjct: 459 GVGQAPPPPPPPPPPPPPPPPPP 481 Score = 33.1 bits (72), Expect = 0.38 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 669 GXXXXPPPXPPPXXKKXXPPPPP 737 G PPP PPP PPPPP Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPP 483 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 468 PPPPPPPPPPPPPPPPPP 485 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 469 PPPPPPPPPPPPPPPPPP 486 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 470 PPPPPPPPPPPPPPPPPP 487 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 477 PPPPPPPPPPPFPPPPPP 494 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 664 GGGGXXXPPPXXPXXKKKXPPPPPP 738 G G PPP P PPPPPP Sbjct: 459 GVGQAPPPPPPPPPPPPPPPPPPPP 483 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 35.5 bits (78), Expect = 0.070 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPPP P PPP PP ++ PPPP Sbjct: 554 PPPPPPGVDIPPPLPP----SEDPKPPPPPPEPPEECPPPPP 591 Score = 30.3 bits (65), Expect = 2.6 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP P + PPPPPP Sbjct: 564 PPPLPPSEDPKPPPPPP 580 Score = 30.3 bits (65), Expect = 2.6 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPP 736 PPPP P + PPPPP Sbjct: 575 PPPPPPEPPEECPPPPP 591 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 673 GXXXPPPXXPXXKKKXPPPPP 735 G PPP P K PPPPP Sbjct: 560 GVDIPPPLPPSEDPKPPPPPP 580 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPP 728 PPPPPPP PPP PPP PP Sbjct: 112 PPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPP 152 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 102 PPPPPPPPPPPPPPPPPP 119 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 102 PPPPPPPPPPPPPPPPPP 119 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 103 PPPPPPPPPPPPPPPPPP 120 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 103 PPPPPPPPPPPPPPPPPP 120 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPP PP PPP P PPP Sbjct: 141 PPPPPPAPCMPPCHQTQVVHSVQLHASPPGPPP---APMPAPPP 181 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 34.3 bits (75), Expect = 0.16 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPPPP P GG PPP PPP PPPP Sbjct: 195 PPPPPPPP-------PPGFPGGA---PPPPPPPF---GAPPPP 224 Score = 32.7 bits (71), Expect = 0.50 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 669 GXXXXPPPXPPPXXKKXXPPPPP 737 G PPP PPP PPPPP Sbjct: 193 GMPPPPPPPPPPGFPGGAPPPPP 215 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +3 Query: 651 PXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGG 776 P G PPP PP PPPPP + GG Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGG 229 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +1 Query: 652 PXXXGGGGXXXPPPXXPXXKKKXPPPPPPXXXLXXXKXXXGG 777 P G PPP P PPPPPP GG Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGG 229 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 28.3 bits (60), Expect(2) = 0.22 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPP 689 PPPPPPP P G PP Sbjct: 796 PPPPPPPPPPEDLIIPLPRRGSDLFAPP 823 Score = 24.2 bits (50), Expect(2) = 0.22 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 576 PXKKXIFXXXPPPPPPP 626 P + + PPPPPPP Sbjct: 784 PEGEGVGGITPPPPPPP 800 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 33.5 bits (73), Expect = 0.28 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 7/51 (13%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXG---GXXXXPPPXPP----PXXKKXXPPPPP 737 PPPPPPP P G PPP PP K PP PP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 >SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 33.5 bits (73), Expect = 0.28 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P + PPPPPP Sbjct: 92 PPPPPPQLENDFPPPPPP 109 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PP PPPPP Sbjct: 92 PPPPPPQLENDFPPPPPP 109 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 33.1 bits (72), Expect = 0.38 Identities = 23/77 (29%), Positives = 24/77 (31%), Gaps = 5/77 (6%) Frame = +3 Query: 522 PP--PPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX 695 PP PP G PP PP PP P PPP Sbjct: 224 PPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPM 283 Query: 696 PP---PXXKKXXPPPPP 737 PP P + PPPPP Sbjct: 284 PPGGMPPNMEQPPPPPP 300 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 5/53 (9%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPP-XPPPXXKKXXPP----PPPXXXS 749 PP PPP P G PPP PPP PP PPP S Sbjct: 249 PPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPPPS 301 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 33.1 bits (72), Expect = 0.38 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPP 704 PP + PP PPPP P GG PPP P P Sbjct: 167 PPAAPFMAPAAPPAPPPP--GAPAAPPAPPFGGPPSAPPPPPAP 208 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP PP P PP PP PPPPP Sbjct: 164 PPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPP 206 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 33.1 bits (72), Expect = 0.38 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 1160 PPPPPPPPPSSPSPPPPP 1177 Score = 33.1 bits (72), Expect = 0.38 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 1161 PPPPPPPPSSPSPPPPPP 1178 Score = 32.7 bits (71), Expect = 0.50 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 1161 PPPPPPPPSSPSPPPPPP 1178 Score = 32.7 bits (71), Expect = 0.50 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 1162 PPPPPPPSSPSPPPPPPP 1179 Score = 32.7 bits (71), Expect = 0.50 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 1162 PPPPPPPSSPSPPPPPPP 1179 Score = 32.7 bits (71), Expect = 0.50 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 1163 PPPPPPSSPSPPPPPPPP 1180 Score = 32.3 bits (70), Expect = 0.66 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPPP P PPP PPP PPP P Sbjct: 1157 PPPPPPP--------PPPPPSSPSPPPPPPPPP------PPPTP 1186 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPP Sbjct: 1160 PPPPPPPPPSSPSPPPPP 1177 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP PPPPPP Sbjct: 1164 PPPPPSSPSPPPPPPPPP 1181 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P P PPPP Sbjct: 1159 PPPPPPPPPPSSPSPPPP 1176 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP PPPPPP Sbjct: 1165 PPPPSSPSPPPPPPPPPP 1182 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPP P PPPPPP Sbjct: 1166 PPPSSPSPPPPPPPPPPP 1183 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 32.7 bits (71), Expect = 0.50 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 867 PPPPPPPPPPPPPPPPPPPASS 888 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 32.7 bits (71), Expect = 0.50 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPPPXPPP 704 PPPPP P GG PP PPP Sbjct: 653 PPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 32.7 bits (71), Expect = 0.50 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 651 PXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P GG PPP PPP PP PP Sbjct: 653 PPPPPGGGMFPPPPPPPPGGGVPGPPKPP 681 Score = 31.9 bits (69), Expect = 0.87 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 621 PPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP P GG PPP PP P PPP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPP 682 Score = 31.9 bits (69), Expect = 0.87 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 513 GGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPP 623 GG PPPP GG F PP P PPPP Sbjct: 650 GGIPPPPPGGG---MFPPPPPPPPGGGVPGPPKPPPP 683 Score = 31.9 bits (69), Expect = 0.87 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 652 PXXXGGGGXXXPPPXXPXXKKKXPPPPPPXXXL 750 P GGG PPP P PP PPP L Sbjct: 654 PPPPGGGMFPPPPPPPPGGGVPGPPKPPPPGNL 686 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPPP P GG P P PP Sbjct: 653 PPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP P PPPPPP Sbjct: 653 PPPPPGGGMFPPPPPPP 669 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 84 PPPPPPPASNVPAPPPPP 101 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 85 PPPPPPASNVPAPPPPPP 102 Score = 29.9 bits (64), Expect = 3.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPP Sbjct: 83 PPPPPPPPASNVPAPPPP 100 Score = 29.9 bits (64), Expect = 3.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPP Sbjct: 84 PPPPPPPASNVPAPPPPP 101 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP P PPP Sbjct: 82 PPPPPPPPPASNVPAPPP 99 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P P PPPP Sbjct: 83 PPPPPPPPASNVPAPPPP 100 Score = 28.7 bits (61), Expect = 8.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PP PPPPP Sbjct: 85 PPPPPPASNVPAPPPPPP 102 Score = 28.7 bits (61), Expect = 8.1 Identities = 15/45 (33%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPP-PXPPP 704 PP + P PPPPP P PP P PPP Sbjct: 571 PPEFSDLESSAPIPPPPPQMNNTSAPPPPNKEKQTAKPPAPLPPP 615 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 32.3 bits (70), Expect = 0.66 Identities = 20/75 (26%), Positives = 21/75 (28%) Frame = +3 Query: 513 GGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPP 692 G P PP + P P PP P GG PP Sbjct: 400 GALPAPPAEKEDQGDYFNLSTPAANMRLPPPPQHTGPPQPRPPHGMPQG--GGPPQLPPN 457 Query: 693 XPPPXXKKXXPPPPP 737 PPP PPPP Sbjct: 458 LPPPPGGMRGMPPPP 472 Score = 28.7 bits (61), Expect = 8.1 Identities = 21/73 (28%), Positives = 21/73 (28%), Gaps = 2/73 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXX--GGXXXXPPPX 695 PPPP G P P PPPP P PPP Sbjct: 428 PPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPF 487 Query: 696 PPPXXKKXXPPPP 734 PP PPPP Sbjct: 488 GPPPPFYRGPPPP 500 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 31.9 bits (69), Expect = 0.87 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 5/60 (8%) Frame = +3 Query: 573 PPXKKXIFXXXPPPP--PPPXXXXXXXXPXXXXGGXXXXPPPX---PPPXXKKXXPPPPP 737 PP + PPPP PP P G P P PPP + PP PP Sbjct: 1225 PPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPP 1284 Score = 28.7 bits (61), Expect = 8.1 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXP-PPXP 698 PPP G F G PP P PP PP P G P PP P Sbjct: 1237 PPPAMPPDGPPKFMGLPPPPP----GMRPMPPQPP---FMPPPPRMQPPGPPGPPGPPGP 1289 Query: 699 PPXXKK 716 P K+ Sbjct: 1290 QPSNKR 1295 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 31.9 bits (69), Expect = 0.87 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 424 PPPPPPPAPLPPPPPPPP 441 Score = 31.9 bits (69), Expect = 0.87 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 424 PPPPPPPAPLPPPPPPPP 441 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PP PPP PPPPP Sbjct: 1307 PPESPPPPPPPPPPPPPP 1324 Score = 28.3 bits (60), Expect(2) = 1.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PP PP Sbjct: 1311 PPPPPPPPPPPPPPPLPP 1328 Score = 21.8 bits (44), Expect(2) = 1.0 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 582 KKXIFXXXPPPPPPP 626 K+ I PPPPPP Sbjct: 1302 KEQIQPPESPPPPPP 1316 >SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) Length = 1440 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPPPP P P PPP + PPPP Sbjct: 1124 PPPPPPPI-------PDDDGDDTDSTQLPNPPPDMQLPDPPPP 1159 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPP 731 PPP PP P PPP PP + PPP Sbjct: 181 PPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPP 222 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 30.3 bits (65), Expect = 2.6 Identities = 27/92 (29%), Positives = 27/92 (29%), Gaps = 19/92 (20%) Frame = +3 Query: 513 GGXPP-----PPXXGGGXXXFXGXXPPXKKXIFXXXPP--------PPP------PPXXX 635 GG PP PP G G G PP PP PPP PP Sbjct: 35 GGYPPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGGPPPSGQYGAPPTSQ 94 Query: 636 XXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPP 731 P G PPP P PPP Sbjct: 95 PYGAPPTSGYPGYQQHPPPPQPSAQSYNAPPP 126 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPP P PP PPPPP Sbjct: 849 PPPPPPVARKPSRSNSTSSQQSIESAPGSPPTGADDFPPPPPP 891 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 29.9 bits (64), Expect = 3.5 Identities = 21/85 (24%), Positives = 21/85 (24%), Gaps = 1/85 (1%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXX 785 PPPP PP P PP P P PP G Sbjct: 39 PPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIGPPGLPGPNG 98 Query: 786 XXXPPXXXXXFXFXXXPXPP-PXXP 857 PP P PP P P Sbjct: 99 VNGPPGELGDMGPPGPPGPPGPQMP 123 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 687 PPXPPPXXKKXXPPPPPXXXSXXKXXXXGG 776 PP PPP PPPPP GG Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPPPPPMGG 224 >SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 29.5 bits (63), Expect = 4.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 669 GXXXXPPPXPPPXXKKXXPPPPP 737 G P P PPP PPPPP Sbjct: 164 GGGEGPNPSPPPSGAPPPPPPPP 186 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 670 GGXXXPPPXXPXXKKKXPPPPPPXXXL 750 GG P P P PPPPPP L Sbjct: 164 GGGEGPNPSPPPSGAPPPPPPPPLFLL 190 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 29.5 bits (63), Expect = 4.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GGGGGG G GGG G GGGGG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGG 106 Score = 29.1 bits (62), Expect = 6.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GGGGGG G GGG G G GGGG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGG 105 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP P PPPPPP Sbjct: 233 PPPPPAAAPPPPPPPPP 249 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 P P PPP PPPPP Sbjct: 231 PAPPPPPAAAPPPPPPPP 248 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 P PP P PPPPPP Sbjct: 231 PAPPPPPAAAPPPPPPPP 248 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 29.5 bits (63), Expect = 4.6 Identities = 22/76 (28%), Positives = 22/76 (28%), Gaps = 5/76 (6%) Frame = +3 Query: 525 PPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPP---PPXXXXXXXXPXXXXGGXXXXP--P 689 PPP PP K P PPP PP P P P Sbjct: 1042 PPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHP 1101 Query: 690 PXPPPXXKKXXPPPPP 737 PPP K P P P Sbjct: 1102 TEPPPRQPKPTPAPRP 1117 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 P PP P PPPPPP Sbjct: 299 PAPPLPNFTSPSPPPPPP 316 Score = 29.5 bits (63), Expect = 4.6 Identities = 19/72 (26%), Positives = 19/72 (26%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP PPPPPPP P Sbjct: 312 PPPPPLPPAMPAMDDLLPPE-----VLSPPPPPPPSEDFYSMPSSLPMPSPPEDLYDAPA 366 Query: 702 PXXKKXXPPPPP 737 PPPPP Sbjct: 367 TLPSPIMPPPPP 378 Score = 28.7 bits (61), Expect = 8.1 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPP 704 PP P PPPPP PPP PPP Sbjct: 298 PPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPP 341 >SB_17878| Best HMM Match : Drf_FH1 (HMM E-Value=0.022) Length = 664 Score = 29.5 bits (63), Expect = 4.6 Identities = 17/64 (26%), Positives = 18/64 (28%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXX 788 P PP P P PP P K+ PP PP S G Sbjct: 485 PLPPLPSRSTIGPLPPITSSASKRILPPLPSKDLKRSLPPLPPKDFSRPLPPLNSGAAIK 544 Query: 789 XXPP 800 PP Sbjct: 545 PLPP 548 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GGGG G + G G G G GGGGGG Sbjct: 822 GGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGG 865 Score = 28.7 bits (61), Expect = 8.1 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GGG GG + G GG G GGGGGG Sbjct: 823 GGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGG 866 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 29.1 bits (62), Expect = 6.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GGGGGG G GGG G GGGGGG Sbjct: 41 GGGGGGG--GGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGG 82 >SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 29.1 bits (62), Expect = 6.1 Identities = 22/80 (27%), Positives = 25/80 (31%), Gaps = 6/80 (7%) Frame = +3 Query: 510 GGGXPPPPXXG----GGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXX 677 GGG P P G G + PP + P PP G Sbjct: 71 GGGPPRGPPRGHPMRGRGAPYGRGGPPSRGPPRGPPLPGPPRRGPPPDRDSGYGGYGDRY 130 Query: 678 XXPPPX--PPPXXKKXXPPP 731 PPP PPP + PPP Sbjct: 131 DRPPPDRRPPPPDRSGYPPP 150 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 29.1 bits (62), Expect = 6.1 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 738 GGGGGGXFFFXXGXGGGG 685 GGGGGG F+ GGGG Sbjct: 122 GGGGGGGGFYQDSYGGGG 139 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P + PP PPP Sbjct: 908 PPPPLPLAPEPPPPLPPP 925 Score = 29.1 bits (62), Expect = 6.1 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 7/49 (14%) Frame = +3 Query: 609 PPPPPP---XXXXXXXXPXXXXGGXXXXPPP----XPPPXXKKXXPPPP 734 PPPPPP P PPP PPP PPPP Sbjct: 923 PPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPP 971 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 1/44 (2%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXP-PPXPPPXXKKXXPPPPP 737 P PPPP P P PP PPP P PP Sbjct: 949 PTPPPPTSALPPPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPP 992 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP PPPPPP Sbjct: 199 PPPPLDDLDDLPPPPPPP 216 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 28.7 bits (61), Expect = 8.1 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP PP P P PP PP K P PP Sbjct: 203 PPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPP 246 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 28.7 bits (61), Expect = 8.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPP PP Sbjct: 198 PPPPAPPGALIPPPPAPP 215 >SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) Length = 872 Score = 26.2 bits (55), Expect(2) = 8.6 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 P P PPP PP PP Sbjct: 792 PTPPPPPRVMNGLPPSPP 809 Score = 20.6 bits (41), Expect(2) = 8.6 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +3 Query: 606 PPPPPPP 626 PP PPPP Sbjct: 791 PPTPPPP 797 >SB_49263| Best HMM Match : Surp (HMM E-Value=1e-28) Length = 641 Score = 24.2 bits (50), Expect(2) = 8.9 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPPPP G P P PPPP Sbjct: 353 PPPPPPPGEGPPEDTQVAVPLG---VPYPVTSHATPTIIPPPP 392 Score = 22.6 bits (46), Expect(2) = 8.9 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPP 623 PP PPPPPP Sbjct: 343 PPIMSVADMIPPPPPPP 359 >SB_40783| Best HMM Match : MH2 (HMM E-Value=0) Length = 494 Score = 25.8 bits (54), Expect(2) = 9.1 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPP 734 PPP PPP PP P Sbjct: 145 PPPLPPPFRATDDPPMP 161 Score = 21.0 bits (42), Expect(2) = 9.1 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPP 626 P ++ + PPP PPP Sbjct: 134 PVPRQSEYPRPPPPLPPP 151 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,928,993 Number of Sequences: 59808 Number of extensions: 317828 Number of successful extensions: 6719 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 655 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2855 length of database: 16,821,457 effective HSP length: 83 effective length of database: 11,857,393 effective search space used: 3082922180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -