BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_B14 (1033 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 50 7e-06 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 50 7e-06 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 50 7e-06 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 50 7e-06 AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p pro... 48 3e-05 AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-P... 48 3e-05 AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-P... 48 3e-05 AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p pro... 47 4e-05 AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA... 47 4e-05 AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB... 47 4e-05 AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 46 8e-05 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 46 8e-05 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 46 8e-05 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 46 8e-05 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 46 8e-05 AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA... 46 1e-04 U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptid... 44 3e-04 BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p pro... 44 3e-04 AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p pro... 44 3e-04 AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-P... 44 3e-04 AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-P... 44 3e-04 AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-P... 44 3e-04 AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-P... 44 3e-04 AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-P... 44 3e-04 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 43 6e-04 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 43 6e-04 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 43 8e-04 BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p pro... 43 8e-04 AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-P... 43 8e-04 AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-P... 43 8e-04 AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. 43 8e-04 AY094861-1|AAM11214.1| 362|Drosophila melanogaster RE22192p pro... 42 0.002 AE014297-3653|AAF56353.1| 362|Drosophila melanogaster CG7016-PA... 42 0.002 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 40 0.004 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 40 0.004 AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p pro... 40 0.006 AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC... 40 0.006 AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB... 40 0.006 AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA... 40 0.006 AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p pro... 40 0.007 AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA... 40 0.007 BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p pro... 39 0.013 BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p pro... 38 0.030 AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p pro... 37 0.052 AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC... 37 0.052 AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB... 37 0.052 AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD... 37 0.052 AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA... 37 0.052 AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-P... 27 0.077 AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p pro... 27 0.078 AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-P... 27 0.078 AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p pro... 27 0.078 AE014296-2355|AAF49762.2| 1155|Drosophila melanogaster CG32138-P... 36 0.12 AE014296-2354|AAF49761.2| 1165|Drosophila melanogaster CG32138-P... 36 0.12 AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p pro... 35 0.21 AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p pro... 35 0.21 AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 p... 35 0.21 AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB,... 35 0.21 AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA... 35 0.21 AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA... 35 0.21 AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA... 35 0.21 BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p pro... 34 0.28 AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA... 34 0.28 X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin pr... 34 0.37 BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p pro... 34 0.37 AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA... 34 0.37 AE014296-862|AAF47912.1| 707|Drosophila melanogaster CG13722-PA... 33 0.48 BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p pro... 33 0.64 BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p pro... 33 0.64 AY118781-1|AAM50641.1| 117|Drosophila melanogaster GH13168p pro... 33 0.64 AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p pro... 33 0.64 AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 p... 33 0.64 AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA... 33 0.64 AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB... 33 0.64 AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC... 33 0.64 AE014297-3096|AAF55954.1| 117|Drosophila melanogaster CG5778-PA... 33 0.64 AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-P... 33 0.64 U18130-1|AAC46512.1| 1047|Drosophila melanogaster masquerade pro... 33 0.84 BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p pro... 33 0.84 BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p pro... 33 0.84 BT016106-1|AAV36991.1| 840|Drosophila melanogaster LD20133p pro... 33 0.84 BT001597-1|AAN71352.1| 1047|Drosophila melanogaster RE29416p pro... 33 0.84 AY052044-1|AAK93468.1| 581|Drosophila melanogaster LP06006p pro... 33 0.84 AE014298-1168|AAF46366.1| 926|Drosophila melanogaster CG10555-P... 33 0.84 AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-P... 33 0.84 AE014296-779|AAF47850.1| 1047|Drosophila melanogaster CG15002-PB... 33 0.84 AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA... 33 0.84 BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p pro... 32 1.1 AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-P... 32 1.1 AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-P... 32 1.1 BT016087-1|AAV36972.1| 749|Drosophila melanogaster LD41296p pro... 32 1.5 BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p pro... 32 1.5 BT003186-1|AAO24941.1| 756|Drosophila melanogaster RE65015p pro... 32 1.5 AY128472-1|AAM75065.1| 836|Drosophila melanogaster RE28238p pro... 32 1.5 AY122174-1|AAM52686.1| 877|Drosophila melanogaster LD34142p pro... 32 1.5 AY051669-1|AAK93093.1| 457|Drosophila melanogaster LD22190p pro... 32 1.5 AJ002520-1|CAC20093.1| 749|Drosophila melanogaster DALAO protei... 32 1.5 AF348329-1|AAK31343.1| 749|Drosophila melanogaster Brahma-assoc... 32 1.5 AE014298-1284|AAF46450.1| 749|Drosophila melanogaster CG7055-PA... 32 1.5 AE014296-2433|AAF49702.1| 2061|Drosophila melanogaster CG9425-PA... 32 1.5 AE014296-2432|AAS65008.1| 2103|Drosophila melanogaster CG9425-PB... 32 1.5 AE014296-1088|AAF50683.1| 239|Drosophila melanogaster CG12330-P... 32 1.5 AE014134-2320|AAN10833.1| 836|Drosophila melanogaster CG6043-PC... 32 1.5 AE014134-2318|AAN10831.1| 759|Drosophila melanogaster CG6043-PB... 32 1.5 AE014134-2317|AAF53274.2| 759|Drosophila melanogaster CG6043-PA... 32 1.5 AE014134-2316|AAN10830.1| 918|Drosophila melanogaster CG6043-PD... 32 1.5 AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA... 32 1.5 AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB... 27 1.5 BT023503-1|AAY84903.1| 1327|Drosophila melanogaster LD20030p pro... 30 2.3 AF116572-1|AAD31170.1| 1327|Drosophila melanogaster ribonuclease... 30 2.3 AE013599-540|AAF59169.1| 1327|Drosophila melanogaster CG8730-PA ... 30 2.3 BT010114-1|AAQ22583.1| 515|Drosophila melanogaster GH02426p pro... 26 2.5 AE014297-3395|AAX52972.1| 515|Drosophila melanogaster CG33111-P... 26 2.5 AE014297-3394|AAS65199.1| 515|Drosophila melanogaster CG33111-P... 26 2.5 AE014297-3393|AAF56193.2| 515|Drosophila melanogaster CG33111-P... 26 2.5 U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding pr... 31 2.6 M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protei... 31 2.6 L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding pr... 31 2.6 BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p pro... 31 2.6 BT023829-1|AAZ86750.1| 107|Drosophila melanogaster RE20030p pro... 31 2.6 BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p pro... 31 2.6 AY166752-1|AAN85714.1| 1400|Drosophila melanogaster loechrig iso... 31 2.6 AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p pro... 31 2.6 AY070541-1|AAL48012.1| 1400|Drosophila melanogaster LD22662p pro... 31 2.6 AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA... 31 2.6 AE014297-2948|AAF55864.2| 1400|Drosophila melanogaster CG17299-P... 31 2.6 AE013599-1936|AAF58220.2| 107|Drosophila melanogaster CG30479-P... 31 2.6 AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-P... 31 2.6 AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p pro... 30 2.7 AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA,... 30 2.7 BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p pro... 30 2.7 AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB,... 30 2.7 L14768-1|AAB39774.1| 1429|Drosophila melanogaster expanded protein. 31 3.4 BT023949-1|ABB36453.1| 1312|Drosophila melanogaster IP03879p pro... 31 3.4 AY069664-1|AAL39809.1| 600|Drosophila melanogaster LD44138p pro... 31 3.4 AY069068-1|AAL39213.1| 1427|Drosophila melanogaster GH08582p pro... 31 3.4 AE014298-2943|AAN09520.1| 1034|Drosophila melanogaster CG11940-P... 31 3.4 AE014298-2942|AAF49029.1| 1162|Drosophila melanogaster CG11940-P... 31 3.4 AE014298-2877|AAF48974.1| 348|Drosophila melanogaster CG14218-P... 31 3.4 AE014298-2334|AAF48566.2| 1311|Drosophila melanogaster CG32577-P... 31 3.4 AE014297-2494|AAN13768.1| 600|Drosophila melanogaster CG7129-PB... 31 3.4 AE014297-2493|AAF55531.1| 600|Drosophila melanogaster CG7129-PA... 31 3.4 AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-P... 31 3.4 AE014134-2469|AAS64704.1| 1853|Drosophila melanogaster CG32972-P... 31 3.4 AE014134-106|AAF51495.1| 1427|Drosophila melanogaster CG4114-PA ... 31 3.4 BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p pro... 30 4.5 AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p pro... 30 4.5 AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p pro... 30 4.5 AE014298-1529|AAF47983.2| 2602|Drosophila melanogaster CG2174-PA... 30 4.5 AE014298-1528|ABI30975.1| 2693|Drosophila melanogaster CG2174-PB... 30 4.5 AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA... 30 4.5 AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA... 30 4.5 X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. 30 6.0 BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p pro... 30 6.0 AY113488-1|AAM29493.1| 435|Drosophila melanogaster RE47056p pro... 30 6.0 AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p pro... 30 6.0 AF053091-1|AAC06254.1| 2715|Drosophila melanogaster eyelid protein. 30 6.0 AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB... 30 6.0 AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA... 30 6.0 AE014298-979|AAF46221.2| 1027|Drosophila melanogaster CG14431-PA... 30 6.0 AE014297-2398|AAN13750.1| 2716|Drosophila melanogaster CG7467-PB... 30 6.0 AE014297-2397|AAS65166.1| 2556|Drosophila melanogaster CG7467-PC... 30 6.0 AE014297-2396|AAF55457.1| 2703|Drosophila melanogaster CG7467-PA... 30 6.0 AE014134-1066|AAF52356.2| 808|Drosophila melanogaster CG31640-P... 30 6.0 AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-P... 30 6.0 AY119067-1|AAM50927.1| 217|Drosophila melanogaster LP08165p pro... 29 7.9 AM412918-1|CAL85541.1| 178|Drosophila melanogaster CG16743 prot... 29 7.9 AE014297-2379|AAF55444.1| 137|Drosophila melanogaster CG14326-P... 29 7.9 AE014134-2984|AAF53715.3| 1377|Drosophila melanogaster CG10600-P... 29 7.9 AE014297-832|AAF54301.3| 2090|Drosophila melanogaster CG31349-PA... 27 8.2 AE014297-834|AAF54300.3| 1371|Drosophila melanogaster CG31349-PB... 27 8.5 D83477-1|BAA11923.1| 1367|Drosophila melanogaster TamA protein. 27 8.5 AE014297-833|AAN13403.2| 1293|Drosophila melanogaster CG31349-PC... 27 8.5 AY061056-1|AAL28604.1| 487|Drosophila melanogaster LD02541p pro... 27 9.2 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 49.6 bits (113), Expect = 7e-06 Identities = 27/74 (36%), Positives = 28/74 (37%), Gaps = 2/74 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP GGG PP PPPPPPP P PPP P Sbjct: 514 PPPPPGGGGAPP--PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPM 571 Query: 702 PXXKK--XXPPPPP 737 P + PPPPP Sbjct: 572 PGMMRPGGGPPPPP 585 Score = 38.7 bits (86), Expect = 0.013 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +3 Query: 606 PPPPPPP---XXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P PPPPP P G PPP PP + PPPPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPP 558 Score = 36.3 bits (80), Expect = 0.069 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 5/69 (7%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXK-----KXXPPPPPXXXSXXKXXXXG 773 PPPPP P G PPP PPP PPPPP G Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPG 573 Query: 774 GXXXXXXPP 800 PP Sbjct: 574 MMRPGGGPP 582 Score = 35.9 bits (79), Expect = 0.091 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 652 PXXXGGGGXXXPPPXXPXXKKKXPPPPPP 738 P GGG PPP P PPPPPP Sbjct: 516 PPPGGGGAPPPPPPPMPGRAGGGPPPPPP 544 Score = 35.1 bits (77), Expect = 0.16 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 652 PXXXGGGGXXXPPPXXPXXKKKXPPPPPP 738 P GGG PPP P PPPPPP Sbjct: 532 PGRAGGGPPPPPPPPMPGRAGGPPPPPPP 560 Score = 32.7 bits (71), Expect = 0.84 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPPPXPP-PXXKKXXPPPPP 737 P P P GG PPP PP P PPPPP Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPP 543 Score = 30.7 bits (66), Expect = 3.4 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 652 PXXXGGGGXXXPPPXXPXXKKKXPPPPPP 738 P GG PPP P + PPPPP Sbjct: 530 PMPGRAGGGPPPPPPPPMPGRAGGPPPPP 558 Score = 30.3 bits (65), Expect = 4.5 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = +2 Query: 665 GGXXXXXPPPPXPXXKKXXP-PPPPP 739 GG PPPP P P PPPPP Sbjct: 536 GGGPPPPPPPPMPGRAGGPPPPPPPP 561 Score = 29.5 bits (63), Expect = 7.9 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -1 Query: 547 PPPXXGGGGXPPP 509 PPP GGGG PPP Sbjct: 514 PPPPPGGGGAPPP 526 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 49.6 bits (113), Expect = 7e-06 Identities = 27/74 (36%), Positives = 28/74 (37%), Gaps = 2/74 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP GGG PP PPPPPPP P PPP P Sbjct: 514 PPPPPGGGGAPP--PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPM 571 Query: 702 PXXKK--XXPPPPP 737 P + PPPPP Sbjct: 572 PGMMRPGGGPPPPP 585 Score = 38.7 bits (86), Expect = 0.013 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +3 Query: 606 PPPPPPP---XXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P PPPPP P G PPP PP + PPPPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPP 558 Score = 36.3 bits (80), Expect = 0.069 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 5/69 (7%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXK-----KXXPPPPPXXXSXXKXXXXG 773 PPPPP P G PPP PPP PPPPP G Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPG 573 Query: 774 GXXXXXXPP 800 PP Sbjct: 574 MMRPGGGPP 582 Score = 35.9 bits (79), Expect = 0.091 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 652 PXXXGGGGXXXPPPXXPXXKKKXPPPPPP 738 P GGG PPP P PPPPPP Sbjct: 516 PPPGGGGAPPPPPPPMPGRAGGGPPPPPP 544 Score = 35.1 bits (77), Expect = 0.16 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 652 PXXXGGGGXXXPPPXXPXXKKKXPPPPPP 738 P GGG PPP P PPPPPP Sbjct: 532 PGRAGGGPPPPPPPPMPGRAGGPPPPPPP 560 Score = 32.7 bits (71), Expect = 0.84 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPPPXPP-PXXKKXXPPPPP 737 P P P GG PPP PP P PPPPP Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPP 543 Score = 30.7 bits (66), Expect = 3.4 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 652 PXXXGGGGXXXPPPXXPXXKKKXPPPPPP 738 P GG PPP P + PPPPP Sbjct: 530 PMPGRAGGGPPPPPPPPMPGRAGGPPPPP 558 Score = 30.3 bits (65), Expect = 4.5 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = +2 Query: 665 GGXXXXXPPPPXPXXKKXXP-PPPPP 739 GG PPPP P P PPPPP Sbjct: 536 GGGPPPPPPPPMPGRAGGPPPPPPPP 561 Score = 29.5 bits (63), Expect = 7.9 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -1 Query: 547 PPPXXGGGGXPPP 509 PPP GGGG PPP Sbjct: 514 PPPPPGGGGAPPP 526 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 49.6 bits (113), Expect = 7e-06 Identities = 27/74 (36%), Positives = 28/74 (37%), Gaps = 2/74 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP GGG PP PPPPPPP P PPP P Sbjct: 514 PPPPPGGGGAPP--PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPM 571 Query: 702 PXXKK--XXPPPPP 737 P + PPPPP Sbjct: 572 PGMMRPGGGPPPPP 585 Score = 38.7 bits (86), Expect = 0.013 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +3 Query: 606 PPPPPPP---XXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P PPPPP P G PPP PP + PPPPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPP 558 Score = 36.3 bits (80), Expect = 0.069 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 5/69 (7%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXK-----KXXPPPPPXXXSXXKXXXXG 773 PPPPP P G PPP PPP PPPPP G Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPG 573 Query: 774 GXXXXXXPP 800 PP Sbjct: 574 MMRPGGGPP 582 Score = 35.9 bits (79), Expect = 0.091 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 652 PXXXGGGGXXXPPPXXPXXKKKXPPPPPP 738 P GGG PPP P PPPPPP Sbjct: 516 PPPGGGGAPPPPPPPMPGRAGGGPPPPPP 544 Score = 35.1 bits (77), Expect = 0.16 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 652 PXXXGGGGXXXPPPXXPXXKKKXPPPPPP 738 P GGG PPP P PPPPPP Sbjct: 532 PGRAGGGPPPPPPPPMPGRAGGPPPPPPP 560 Score = 32.7 bits (71), Expect = 0.84 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPPPXPP-PXXKKXXPPPPP 737 P P P GG PPP PP P PPPPP Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPP 543 Score = 30.7 bits (66), Expect = 3.4 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 652 PXXXGGGGXXXPPPXXPXXKKKXPPPPPP 738 P GG PPP P + PPPPP Sbjct: 530 PMPGRAGGGPPPPPPPPMPGRAGGPPPPP 558 Score = 30.3 bits (65), Expect = 4.5 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = +2 Query: 665 GGXXXXXPPPPXPXXKKXXP-PPPPP 739 GG PPPP P P PPPPP Sbjct: 536 GGGPPPPPPPPMPGRAGGPPPPPPPP 561 Score = 29.5 bits (63), Expect = 7.9 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -1 Query: 547 PPPXXGGGGXPPP 509 PPP GGGG PPP Sbjct: 514 PPPPPGGGGAPPP 526 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 49.6 bits (113), Expect = 7e-06 Identities = 27/74 (36%), Positives = 28/74 (37%), Gaps = 2/74 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP GGG PP PPPPPPP P PPP P Sbjct: 514 PPPPPGGGGAPP--PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPM 571 Query: 702 PXXKK--XXPPPPP 737 P + PPPPP Sbjct: 572 PGMMRPGGGPPPPP 585 Score = 38.7 bits (86), Expect = 0.013 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +3 Query: 606 PPPPPPP---XXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P PPPPP P G PPP PP + PPPPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPP 558 Score = 36.3 bits (80), Expect = 0.069 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 5/69 (7%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXK-----KXXPPPPPXXXSXXKXXXXG 773 PPPPP P G PPP PPP PPPPP G Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPG 573 Query: 774 GXXXXXXPP 800 PP Sbjct: 574 MMRPGGGPP 582 Score = 35.9 bits (79), Expect = 0.091 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 652 PXXXGGGGXXXPPPXXPXXKKKXPPPPPP 738 P GGG PPP P PPPPPP Sbjct: 516 PPPGGGGAPPPPPPPMPGRAGGGPPPPPP 544 Score = 35.1 bits (77), Expect = 0.16 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 652 PXXXGGGGXXXPPPXXPXXKKKXPPPPPP 738 P GGG PPP P PPPPPP Sbjct: 532 PGRAGGGPPPPPPPPMPGRAGGPPPPPPP 560 Score = 32.7 bits (71), Expect = 0.84 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPPPXPP-PXXKKXXPPPPP 737 P P P GG PPP PP P PPPPP Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPP 543 Score = 30.7 bits (66), Expect = 3.4 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 652 PXXXGGGGXXXPPPXXPXXKKKXPPPPPP 738 P GG PPP P + PPPPP Sbjct: 530 PMPGRAGGGPPPPPPPPMPGRAGGPPPPP 558 Score = 30.3 bits (65), Expect = 4.5 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = +2 Query: 665 GGXXXXXPPPPXPXXKKXXP-PPPPP 739 GG PPPP P P PPPPP Sbjct: 536 GGGPPPPPPPPMPGRAGGPPPPPPPP 561 Score = 29.5 bits (63), Expect = 7.9 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -1 Query: 547 PPPXXGGGGXPPP 509 PPP GGGG PPP Sbjct: 514 PPPPPGGGGAPPP 526 >AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p protein. Length = 514 Score = 47.6 bits (108), Expect = 3e-05 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSX 752 PP PPPP PP P G PPP PP PPPPP S Sbjct: 373 PPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPPMQKSQ 432 Query: 753 XK 758 K Sbjct: 433 PK 434 Score = 29.9 bits (64), Expect = 6.0 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +3 Query: 606 PPPPPPP--XXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P PPPP P G PPP P PPPPP Sbjct: 369 PVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPP 414 >AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-PA, isoform A protein. Length = 514 Score = 47.6 bits (108), Expect = 3e-05 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSX 752 PP PPPP PP P G PPP PP PPPPP S Sbjct: 373 PPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPPMQKSQ 432 Query: 753 XK 758 K Sbjct: 433 PK 434 Score = 29.9 bits (64), Expect = 6.0 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +3 Query: 606 PPPPPPP--XXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P PPPP P G PPP P PPPPP Sbjct: 369 PVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPP 414 >AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-PB, isoform B protein. Length = 630 Score = 47.6 bits (108), Expect = 3e-05 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSX 752 PP PPPP PP P G PPP PP PPPPP S Sbjct: 489 PPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPPMQKSQ 548 Query: 753 XK 758 K Sbjct: 549 PK 550 Score = 29.9 bits (64), Expect = 6.0 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +3 Query: 606 PPPPPPP--XXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P PPPP P G PPP P PPPPP Sbjct: 485 PVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPP 530 >AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p protein. Length = 846 Score = 47.2 bits (107), Expect = 4e-05 Identities = 27/97 (27%), Positives = 28/97 (28%), Gaps = 6/97 (6%) Frame = +3 Query: 573 PPXKKXIFXXXPP------PPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PP + PP PPPPP P PPP PPP K PPPP Sbjct: 142 PPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPP 201 Query: 735 PXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPP 845 P PP P PP Sbjct: 202 PAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAPP 238 Score = 42.3 bits (95), Expect = 0.001 Identities = 31/112 (27%), Positives = 33/112 (29%), Gaps = 4/112 (3%) Frame = +3 Query: 525 PPPXXGGGXXXFXGXXPPXKKXIFXXXPP----PPPPPXXXXXXXXPXXXXGGXXXXPPP 692 PPP G G PP F PP PPPPP P PPP Sbjct: 107 PPPPAPPGVESPPGPQPPASPR-FDPPPPHTIEPPPPPA--PPTLVPPPPPAPPTIKPPP 163 Query: 693 XPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPP 848 P P + PPPPP + PP P P P Sbjct: 164 PPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAP 215 Score = 40.7 bits (91), Expect = 0.003 Identities = 26/99 (26%), Positives = 27/99 (27%), Gaps = 4/99 (4%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX----PPPXXKKXXPPPPPX 740 PP + PPPP P P PPP PPP PPPP Sbjct: 95 PPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPP 154 Query: 741 XXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 K PP P PPP P Sbjct: 155 APPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAP 193 Score = 33.9 bits (74), Expect = 0.37 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPP P P G PP PP + PPPP Sbjct: 94 PPPPPRPASPKVEPPPPAPPG--VESPPGPQPPASPRFDPPPP 134 Score = 31.5 bits (68), Expect = 1.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P K PPPP P Sbjct: 95 PPPPRPASPKVEPPPPAP 112 Score = 29.9 bits (64), Expect = 6.0 Identities = 20/75 (26%), Positives = 21/75 (28%), Gaps = 6/75 (8%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP------PPPPXXXXXXXXPXXXXGGXXXX 683 PPPP PP PPP PPPP P Sbjct: 172 PPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVEL 231 Query: 684 PPPXPPPXXKKXXPP 728 PPP PP + P Sbjct: 232 PPPPAPPKAEAAITP 246 >AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA, isoform A protein. Length = 1109 Score = 47.2 bits (107), Expect = 4e-05 Identities = 27/97 (27%), Positives = 28/97 (28%), Gaps = 6/97 (6%) Frame = +3 Query: 573 PPXKKXIFXXXPP------PPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PP + PP PPPPP P PPP PPP K PPPP Sbjct: 405 PPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPP 464 Query: 735 PXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPP 845 P PP P PP Sbjct: 465 PAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAPP 501 Score = 42.3 bits (95), Expect = 0.001 Identities = 31/112 (27%), Positives = 33/112 (29%), Gaps = 4/112 (3%) Frame = +3 Query: 525 PPPXXGGGXXXFXGXXPPXKKXIFXXXPP----PPPPPXXXXXXXXPXXXXGGXXXXPPP 692 PPP G G PP F PP PPPPP P PPP Sbjct: 370 PPPPAPPGVESPPGPQPPASPR-FDPPPPHTIEPPPPPA--PPTLVPPPPPAPPTIKPPP 426 Query: 693 XPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPP 848 P P + PPPPP + PP P P P Sbjct: 427 PPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAP 478 Score = 40.7 bits (91), Expect = 0.003 Identities = 26/99 (26%), Positives = 27/99 (27%), Gaps = 4/99 (4%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX----PPPXXKKXXPPPPPX 740 PP + PPPP P P PPP PPP PPPP Sbjct: 358 PPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPP 417 Query: 741 XXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 K PP P PPP P Sbjct: 418 APPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAP 456 Score = 33.9 bits (74), Expect = 0.37 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPP P P G PP PP + PPPP Sbjct: 357 PPPPPRPASPKVEPPPPAPPG--VESPPGPQPPASPRFDPPPP 397 Score = 31.5 bits (68), Expect = 1.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P K PPPP P Sbjct: 358 PPPPRPASPKVEPPPPAP 375 Score = 29.9 bits (64), Expect = 6.0 Identities = 20/75 (26%), Positives = 21/75 (28%), Gaps = 6/75 (8%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP------PPPPXXXXXXXXPXXXXGGXXXX 683 PPPP PP PPP PPPP P Sbjct: 435 PPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVEL 494 Query: 684 PPPXPPPXXKKXXPP 728 PPP PP + P Sbjct: 495 PPPPAPPKAEAAITP 509 >AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB, isoform B protein. Length = 1150 Score = 47.2 bits (107), Expect = 4e-05 Identities = 27/97 (27%), Positives = 28/97 (28%), Gaps = 6/97 (6%) Frame = +3 Query: 573 PPXKKXIFXXXPP------PPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PP + PP PPPPP P PPP PPP K PPPP Sbjct: 405 PPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPP 464 Query: 735 PXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPP 845 P PP P PP Sbjct: 465 PAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAPP 501 Score = 42.3 bits (95), Expect = 0.001 Identities = 31/112 (27%), Positives = 33/112 (29%), Gaps = 4/112 (3%) Frame = +3 Query: 525 PPPXXGGGXXXFXGXXPPXKKXIFXXXPP----PPPPPXXXXXXXXPXXXXGGXXXXPPP 692 PPP G G PP F PP PPPPP P PPP Sbjct: 370 PPPPAPPGVESPPGPQPPASPR-FDPPPPHTIEPPPPPA--PPTLVPPPPPAPPTIKPPP 426 Query: 693 XPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPP 848 P P + PPPPP + PP P P P Sbjct: 427 PPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAP 478 Score = 40.7 bits (91), Expect = 0.003 Identities = 26/99 (26%), Positives = 27/99 (27%), Gaps = 4/99 (4%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX----PPPXXKKXXPPPPPX 740 PP + PPPP P P PPP PPP PPPP Sbjct: 358 PPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPP 417 Query: 741 XXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 K PP P PPP P Sbjct: 418 APPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAP 456 Score = 33.9 bits (74), Expect = 0.37 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPP P P G PP PP + PPPP Sbjct: 357 PPPPPRPASPKVEPPPPAPPG--VESPPGPQPPASPRFDPPPP 397 Score = 31.5 bits (68), Expect = 1.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P K PPPP P Sbjct: 358 PPPPRPASPKVEPPPPAP 375 Score = 29.9 bits (64), Expect = 6.0 Identities = 20/75 (26%), Positives = 21/75 (28%), Gaps = 6/75 (8%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP------PPPPXXXXXXXXPXXXXGGXXXX 683 PPPP PP PPP PPPP P Sbjct: 435 PPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVEL 494 Query: 684 PPPXPPPXXKKXXPP 728 PPP PP + P Sbjct: 495 PPPPAPPKAEAAITP 509 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 46.0 bits (104), Expect = 8e-05 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP F PPPPPPP P G PPP PPP PPPPP Sbjct: 480 PPPPLHAFVAPPPPPPPPPPPPP---PLANYGAPP--PPPPPPPGSGSAPPPPPP 529 Score = 43.2 bits (97), Expect = 6e-04 Identities = 27/82 (32%), Positives = 28/82 (34%), Gaps = 3/82 (3%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP F PP PPPPPP P G PPP PP Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPP-----PPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 Query: 702 PXXKKXX---PPPPPXXXSXXK 758 + PPPPP S K Sbjct: 530 APIEGGGGIPPPPPPMSASPSK 551 Score = 34.3 bits (75), Expect = 0.28 Identities = 21/71 (29%), Positives = 22/71 (30%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP PPPPPP P GG PPP Sbjct: 495 PPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPA-------PIEGGGGIPPPPPPMSA 547 Query: 702 PXXKKXXPPPP 734 K P P Sbjct: 548 SPSKTTISPAP 558 Score = 31.1 bits (67), Expect = 2.6 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = +3 Query: 684 PPPXPPPXXK--KXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PPP PPP PPPPP G PP P PPP P Sbjct: 477 PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGS-----GSAPPPPPPAP 531 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 46.0 bits (104), Expect = 8e-05 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP F PPPPPPP P G PPP PPP PPPPP Sbjct: 490 PPPPLHAFVAPPPPPPPPPPPPP---PLANYGAPP--PPPPPPPGSGSAPPPPPP 539 Score = 43.2 bits (97), Expect = 6e-04 Identities = 27/82 (32%), Positives = 28/82 (34%), Gaps = 3/82 (3%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP F PP PPPPPP P G PPP PP Sbjct: 485 PPPPPPPPPLHAFVAPPPPPPPP-----PPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 539 Query: 702 PXXKKXX---PPPPPXXXSXXK 758 + PPPPP S K Sbjct: 540 APIEGGGGIPPPPPPMSASPSK 561 Score = 34.3 bits (75), Expect = 0.28 Identities = 21/71 (29%), Positives = 22/71 (30%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP PPPPPP P GG PPP Sbjct: 505 PPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPA-------PIEGGGGIPPPPPPMSA 557 Query: 702 PXXKKXXPPPP 734 K P P Sbjct: 558 SPSKTTISPAP 568 Score = 31.1 bits (67), Expect = 2.6 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = +3 Query: 684 PPPXPPPXXK--KXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PPP PPP PPPPP G PP P PPP P Sbjct: 487 PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGS-----GSAPPPPPPAP 541 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 46.0 bits (104), Expect = 8e-05 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP F PPPPPPP P G PPP PPP PPPPP Sbjct: 480 PPPPLHAFVAPPPPPPPPPPPPP---PLANYGAPP--PPPPPPPGSGSAPPPPPP 529 Score = 43.2 bits (97), Expect = 6e-04 Identities = 27/82 (32%), Positives = 28/82 (34%), Gaps = 3/82 (3%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP F PP PPPPPP P G PPP PP Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPP-----PPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 Query: 702 PXXKKXX---PPPPPXXXSXXK 758 + PPPPP S K Sbjct: 530 APIEGGGGIPPPPPPMSASPSK 551 Score = 34.3 bits (75), Expect = 0.28 Identities = 21/71 (29%), Positives = 22/71 (30%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP PPPPPP P GG PPP Sbjct: 495 PPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPA-------PIEGGGGIPPPPPPMSA 547 Query: 702 PXXKKXXPPPP 734 K P P Sbjct: 548 SPSKTTISPAP 558 Score = 31.1 bits (67), Expect = 2.6 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = +3 Query: 684 PPPXPPPXXK--KXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PPP PPP PPPPP G PP P PPP P Sbjct: 477 PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGS-----GSAPPPPPPAP 531 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 46.0 bits (104), Expect = 8e-05 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP F PPPPPPP P G PPP PPP PPPPP Sbjct: 638 PPPPLHAFVAPPPPPPPPPPPPP---PLANYGAPP--PPPPPPPGSGSAPPPPPP 687 Score = 43.2 bits (97), Expect = 6e-04 Identities = 27/82 (32%), Positives = 28/82 (34%), Gaps = 3/82 (3%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP F PP PPPPPP P G PPP PP Sbjct: 633 PPPPPPPPPLHAFVAPPPPPPPP-----PPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 687 Query: 702 PXXKKXX---PPPPPXXXSXXK 758 + PPPPP S K Sbjct: 688 APIEGGGGIPPPPPPMSASPSK 709 Score = 34.3 bits (75), Expect = 0.28 Identities = 21/71 (29%), Positives = 22/71 (30%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP PPPPPP P GG PPP Sbjct: 653 PPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPA-------PIEGGGGIPPPPPPMSA 705 Query: 702 PXXKKXXPPPP 734 K P P Sbjct: 706 SPSKTTISPAP 716 Score = 31.1 bits (67), Expect = 2.6 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = +3 Query: 684 PPPXPPPXXK--KXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PPP PPP PPPPP G PP P PPP P Sbjct: 635 PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGS-----GSAPPPPPPAP 689 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 46.0 bits (104), Expect = 8e-05 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP F PPPPPPP P G PPP PPP PPPPP Sbjct: 585 PPPPLHAFVAPPPPPPPPPPPPP---PLANYGAPP--PPPPPPPGSGSAPPPPPP 634 Score = 43.2 bits (97), Expect = 6e-04 Identities = 27/82 (32%), Positives = 28/82 (34%), Gaps = 3/82 (3%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP F PP PPPPPP P G PPP PP Sbjct: 580 PPPPPPPPPLHAFVAPPPPPPPP-----PPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 634 Query: 702 PXXKKXX---PPPPPXXXSXXK 758 + PPPPP S K Sbjct: 635 APIEGGGGIPPPPPPMSASPSK 656 Score = 34.3 bits (75), Expect = 0.28 Identities = 21/71 (29%), Positives = 22/71 (30%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP PPPPPP P GG PPP Sbjct: 600 PPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPA-------PIEGGGGIPPPPPPMSA 652 Query: 702 PXXKKXXPPPP 734 K P P Sbjct: 653 SPSKTTISPAP 663 Score = 31.1 bits (67), Expect = 2.6 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = +3 Query: 684 PPPXPPPXXK--KXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PPP PPP PPPPP G PP P PPP P Sbjct: 582 PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGS-----GSAPPPPPPAP 636 >AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA protein. Length = 440 Score = 45.6 bits (103), Expect = 1e-04 Identities = 22/54 (40%), Positives = 23/54 (42%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PP KK I+ PPPPPP P PPP PPP K PPP Sbjct: 271 PPTKKVIYT--PPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPPKKVVYTPPP 322 Score = 45.2 bits (102), Expect = 1e-04 Identities = 21/55 (38%), Positives = 23/55 (41%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP KK ++ PPPPPP P PPP PP PPPPP Sbjct: 158 PPTKKVVYT--PPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPP 210 Score = 45.2 bits (102), Expect = 1e-04 Identities = 21/54 (38%), Positives = 23/54 (42%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PP KK ++ PPPPPP P PPP PPP K PPP Sbjct: 171 PPTKKVVYT--PPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPPKKVVYTPPP 222 Score = 39.9 bits (89), Expect = 0.006 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP KK + P PPP P PP PPP K PPPP Sbjct: 142 PPTKKVVIAPPPVYVPPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPP 196 Score = 39.9 bits (89), Expect = 0.006 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP KK + P PPP P PP PPP K PPPP Sbjct: 255 PPTKKVVIAPPPVYVPPPTKKVIYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPP 309 Score = 37.5 bits (83), Expect = 0.030 Identities = 24/69 (34%), Positives = 25/69 (36%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP KK + PPPPPPP P PPP PP Sbjct: 354 PPPPTKKVYVAPPVYVPPPTKKVVVYT-PPPPPPP-----VYIPPPTKKVVVYTPPPPPP 407 Query: 702 PXXKKXXPP 728 P K P Sbjct: 408 PTKKVYVTP 416 Score = 35.9 bits (79), Expect = 0.091 Identities = 25/79 (31%), Positives = 27/79 (34%), Gaps = 7/79 (8%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXP--XXXXGGXXXXPPP- 692 PPPP PP KK ++ PPPPPPP P G P Sbjct: 280 PPPPPPTKKVVYTPPPPPPTKKVVYTP-PPPPPPPKKVVYTPPPTGILKDDGYHYGQPSV 338 Query: 693 ----XPPPXXKKXXPPPPP 737 PP K PPPP Sbjct: 339 KFEVSAPPAPKVEYLPPPP 357 Score = 33.9 bits (74), Expect = 0.37 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPP 626 PPPP PP KK ++ PPPPPPP Sbjct: 180 PPPPPPTKKVVYTPPPPPPTKKVVYTP-PPPPPPP 213 Score = 31.1 bits (67), Expect = 2.6 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P K PPPPP Sbjct: 167 PPPPPPTKKVVYTPPPPP 184 Score = 31.1 bits (67), Expect = 2.6 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P K PPPPP Sbjct: 180 PPPPPPTKKVVYTPPPPP 197 Score = 31.1 bits (67), Expect = 2.6 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P K PPPPP Sbjct: 193 PPPPPPTKKVVYTPPPPP 210 Score = 31.1 bits (67), Expect = 2.6 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P K PPPPP Sbjct: 280 PPPPPPTKKVVYTPPPPP 297 Score = 31.1 bits (67), Expect = 2.6 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P K PPPPP Sbjct: 293 PPPPPPTKKVVYTPPPPP 310 Score = 29.5 bits (63), Expect = 7.9 Identities = 21/61 (34%), Positives = 23/61 (37%), Gaps = 6/61 (9%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXP---PPXXKK---XXPPPP 734 PP K ++ P PPP P PPP P PP KK PPPP Sbjct: 355 PPPTKKVYVAPPVYVPPPTKKVVVYTP---------PPPPPPVYIPPPTKKVVVYTPPPP 405 Query: 735 P 737 P Sbjct: 406 P 406 >U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptide protein. Length = 684 Score = 44.4 bits (100), Expect = 3e-04 Identities = 25/69 (36%), Positives = 26/69 (37%), Gaps = 8/69 (11%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXP--------PPPPPPXXXXXXXXPXXXXGGXX 677 PPPP GG G PP +F P PPP PP P GG Sbjct: 411 PPPPSFGGAAGG--GPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPG 468 Query: 678 XXPPPXPPP 704 PPP PPP Sbjct: 469 APPPPPPPP 477 Score = 34.3 bits (75), Expect = 0.28 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP-PXXKKXXPPPPP 737 PPPP P P GG PPP PP P PPP P Sbjct: 424 PPPPAPPQMFNGAPPPPAMGG---GPPPAPPAPPAMGGGPPPAP 464 Score = 32.3 bits (70), Expect = 1.1 Identities = 23/84 (27%), Positives = 23/84 (27%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXX 785 PP P PP P G PPP PP PPPP Sbjct: 404 PPAPAPPPP------PPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMG 457 Query: 786 XXXPPXXXXXFXFXXXPXPPPXXP 857 PP P PPP P Sbjct: 458 GGPPPAPGG----PGAPPPPPPPP 477 >BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p protein. Length = 687 Score = 44.4 bits (100), Expect = 3e-04 Identities = 25/69 (36%), Positives = 26/69 (37%), Gaps = 8/69 (11%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXP--------PPPPPPXXXXXXXXPXXXXGGXX 677 PPPP GG G PP +F P PPP PP P GG Sbjct: 414 PPPPSFGGAAGG--GPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPG 471 Query: 678 XXPPPXPPP 704 PPP PPP Sbjct: 472 APPPPPPPP 480 Score = 34.3 bits (75), Expect = 0.28 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP-PXXKKXXPPPPP 737 PPPP P P GG PPP PP P PPP P Sbjct: 427 PPPPAPPQMFNGAPPPPAMGG---GPPPAPPAPPAMGGGPPPAP 467 Score = 32.3 bits (70), Expect = 1.1 Identities = 23/84 (27%), Positives = 23/84 (27%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXX 785 PP P PP P G PPP PP PPPP Sbjct: 407 PPAPAPPPP------PPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMG 460 Query: 786 XXXPPXXXXXFXFXXXPXPPPXXP 857 PP P PPP P Sbjct: 461 GGPPPAPGG----PGAPPPPPPPP 480 >AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p protein. Length = 831 Score = 44.4 bits (100), Expect = 3e-04 Identities = 25/69 (36%), Positives = 26/69 (37%), Gaps = 8/69 (11%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXP--------PPPPPPXXXXXXXXPXXXXGGXX 677 PPPP GG G PP +F P PPP PP P GG Sbjct: 557 PPPPSFGGAAGG--GPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPG 614 Query: 678 XXPPPXPPP 704 PPP PPP Sbjct: 615 APPPPPPPP 623 Score = 34.3 bits (75), Expect = 0.28 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP-PXXKKXXPPPPP 737 PPPP P P GG PPP PP P PPP P Sbjct: 570 PPPPAPPQMFNGAPPPPAMGG---GPPPAPPAPPAMGGGPPPAP 610 Score = 32.3 bits (70), Expect = 1.1 Identities = 23/84 (27%), Positives = 23/84 (27%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXX 785 PP P PP P G PPP PP PPPP Sbjct: 550 PPAPAPPPP------PPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMG 603 Query: 786 XXXPPXXXXXFXFXXXPXPPPXXP 857 PP P PPP P Sbjct: 604 GGPPPAPGG----PGAPPPPPPPP 623 >AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-PB, isoform B protein. Length = 829 Score = 44.4 bits (100), Expect = 3e-04 Identities = 25/69 (36%), Positives = 26/69 (37%), Gaps = 8/69 (11%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXP--------PPPPPPXXXXXXXXPXXXXGGXX 677 PPPP GG G PP +F P PPP PP P GG Sbjct: 556 PPPPSFGGAAGG--GPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPG 613 Query: 678 XXPPPXPPP 704 PPP PPP Sbjct: 614 APPPPPPPP 622 Score = 34.3 bits (75), Expect = 0.28 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP-PXXKKXXPPPPP 737 PPPP P P GG PPP PP P PPP P Sbjct: 569 PPPPAPPQMFNGAPPPPAMGG---GPPPAPPAPPAMGGGPPPAP 609 Score = 32.3 bits (70), Expect = 1.1 Identities = 23/84 (27%), Positives = 23/84 (27%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXX 785 PP P PP P G PPP PP PPPP Sbjct: 549 PPAPAPPPP------PPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMG 602 Query: 786 XXXPPXXXXXFXFXXXPXPPPXXP 857 PP P PPP P Sbjct: 603 GGPPPAPGG----PGAPPPPPPPP 622 >AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-PE, isoform E protein. Length = 684 Score = 44.4 bits (100), Expect = 3e-04 Identities = 25/69 (36%), Positives = 26/69 (37%), Gaps = 8/69 (11%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXP--------PPPPPPXXXXXXXXPXXXXGGXX 677 PPPP GG G PP +F P PPP PP P GG Sbjct: 411 PPPPSFGGAAGG--GPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPG 468 Query: 678 XXPPPXPPP 704 PPP PPP Sbjct: 469 APPPPPPPP 477 Score = 34.3 bits (75), Expect = 0.28 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP-PXXKKXXPPPPP 737 PPPP P P GG PPP PP P PPP P Sbjct: 424 PPPPAPPQMFNGAPPPPAMGG---GPPPAPPAPPAMGGGPPPAP 464 Score = 32.3 bits (70), Expect = 1.1 Identities = 23/84 (27%), Positives = 23/84 (27%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXX 785 PP P PP P G PPP PP PPPP Sbjct: 404 PPAPAPPPP------PPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMG 457 Query: 786 XXXPPXXXXXFXFXXXPXPPPXXP 857 PP P PPP P Sbjct: 458 GGPPPAPGG----PGAPPPPPPPP 477 >AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-PC, isoform C protein. Length = 684 Score = 44.4 bits (100), Expect = 3e-04 Identities = 25/69 (36%), Positives = 26/69 (37%), Gaps = 8/69 (11%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXP--------PPPPPPXXXXXXXXPXXXXGGXX 677 PPPP GG G PP +F P PPP PP P GG Sbjct: 411 PPPPSFGGAAGG--GPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPG 468 Query: 678 XXPPPXPPP 704 PPP PPP Sbjct: 469 APPPPPPPP 477 Score = 34.3 bits (75), Expect = 0.28 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP-PXXKKXXPPPPP 737 PPPP P P GG PPP PP P PPP P Sbjct: 424 PPPPAPPQMFNGAPPPPAMGG---GPPPAPPAPPAMGGGPPPAP 464 Score = 32.3 bits (70), Expect = 1.1 Identities = 23/84 (27%), Positives = 23/84 (27%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXX 785 PP P PP P G PPP PP PPPP Sbjct: 404 PPAPAPPPP------PPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMG 457 Query: 786 XXXPPXXXXXFXFXXXPXPPPXXP 857 PP P PPP P Sbjct: 458 GGPPPAPGG----PGAPPPPPPPP 477 >AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-PA, isoform A protein. Length = 684 Score = 44.4 bits (100), Expect = 3e-04 Identities = 25/69 (36%), Positives = 26/69 (37%), Gaps = 8/69 (11%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXP--------PPPPPPXXXXXXXXPXXXXGGXX 677 PPPP GG G PP +F P PPP PP P GG Sbjct: 411 PPPPSFGGAAGG--GPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPG 468 Query: 678 XXPPPXPPP 704 PPP PPP Sbjct: 469 APPPPPPPP 477 Score = 34.3 bits (75), Expect = 0.28 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP-PXXKKXXPPPPP 737 PPPP P P GG PPP PP P PPP P Sbjct: 424 PPPPAPPQMFNGAPPPPAMGG---GPPPAPPAPPAMGGGPPPAP 464 Score = 32.3 bits (70), Expect = 1.1 Identities = 23/84 (27%), Positives = 23/84 (27%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXX 785 PP P PP P G PPP PP PPPP Sbjct: 404 PPAPAPPPP------PPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMG 457 Query: 786 XXXPPXXXXXFXFXXXPXPPPXXP 857 PP P PPP P Sbjct: 458 GGPPPAPGG----PGAPPPPPPPP 477 >AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-PD, isoform D protein. Length = 687 Score = 44.4 bits (100), Expect = 3e-04 Identities = 25/69 (36%), Positives = 26/69 (37%), Gaps = 8/69 (11%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXP--------PPPPPPXXXXXXXXPXXXXGGXX 677 PPPP GG G PP +F P PPP PP P GG Sbjct: 414 PPPPSFGGAAGG--GPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPG 471 Query: 678 XXPPPXPPP 704 PPP PPP Sbjct: 472 APPPPPPPP 480 Score = 34.3 bits (75), Expect = 0.28 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP-PXXKKXXPPPPP 737 PPPP P P GG PPP PP P PPP P Sbjct: 427 PPPPAPPQMFNGAPPPPAMGG---GPPPAPPAPPAMGGGPPPAP 467 Score = 32.3 bits (70), Expect = 1.1 Identities = 23/84 (27%), Positives = 23/84 (27%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXX 785 PP P PP P G PPP PP PPPP Sbjct: 407 PPAPAPPPP------PPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMG 460 Query: 786 XXXPPXXXXXFXFXXXPXPPPXXP 857 PP P PPP P Sbjct: 461 GGPPPAPGG----PGAPPPPPPPP 480 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 43.2 bits (97), Expect = 6e-04 Identities = 27/82 (32%), Positives = 28/82 (34%), Gaps = 3/82 (3%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP F PP PPPPPP P G PPP PP Sbjct: 580 PPPPPPPPPLPAFVAPPPPPPP------PPPPPPMANYGAPPPPPPPPPGSGSAPPPPPP 633 Query: 702 PXXKKXX---PPPPPXXXSXXK 758 + PPPPP S K Sbjct: 634 APIEGGGGIPPPPPPMSASPSK 655 Score = 34.3 bits (75), Expect = 0.28 Identities = 21/71 (29%), Positives = 22/71 (30%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP PPPPPP P GG PPP Sbjct: 599 PPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPA-------PIEGGGGIPPPPPPMSA 651 Query: 702 PXXKKXXPPPP 734 K P P Sbjct: 652 SPSKTTISPAP 662 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 1/59 (1%) Frame = +3 Query: 684 PPPXPPPXXK-KXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PPP PPP PPPPP G PP P PPP P Sbjct: 582 PPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGS-----GSAPPPPPPAP 635 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 43.2 bits (97), Expect = 6e-04 Identities = 27/82 (32%), Positives = 28/82 (34%), Gaps = 3/82 (3%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP F PP PPPPPP P G PPP PP Sbjct: 713 PPPPPPPPPLPAFVAPPPPPPP------PPPPPPMANYGAPPPPPPPPPGSGSAPPPPPP 766 Query: 702 PXXKKXX---PPPPPXXXSXXK 758 + PPPPP S K Sbjct: 767 APIEGGGGIPPPPPPMSASPSK 788 Score = 34.3 bits (75), Expect = 0.28 Identities = 21/71 (29%), Positives = 22/71 (30%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP PPPPPP P GG PPP Sbjct: 732 PPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPA-------PIEGGGGIPPPPPPMSA 784 Query: 702 PXXKKXXPPPP 734 K P P Sbjct: 785 SPSKTTISPAP 795 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 1/59 (1%) Frame = +3 Query: 684 PPPXPPPXXK-KXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PPP PPP PPPPP G PP P PPP P Sbjct: 715 PPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGS-----GSAPPPPPPAP 768 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 42.7 bits (96), Expect = 8e-04 Identities = 27/82 (32%), Positives = 28/82 (34%), Gaps = 3/82 (3%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP F PP PPPPPP P G PPP PP Sbjct: 485 PPPPPPPPPLPAFVAPPPPPPP------PPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 538 Query: 702 PXXKKXX---PPPPPXXXSXXK 758 + PPPPP S K Sbjct: 539 APIEGGGGIPPPPPPMSASPSK 560 Score = 34.3 bits (75), Expect = 0.28 Identities = 21/71 (29%), Positives = 22/71 (30%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP PPPPPP P GG PPP Sbjct: 504 PPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPA-------PIEGGGGIPPPPPPMSA 556 Query: 702 PXXKKXXPPPP 734 K P P Sbjct: 557 SPSKTTISPAP 567 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 1/59 (1%) Frame = +3 Query: 684 PPPXPPPXXK-KXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PPP PPP PPPPP G PP P PPP P Sbjct: 487 PPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGS-----GSAPPPPPPAP 540 >BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p protein. Length = 145 Score = 42.7 bits (96), Expect = 8e-04 Identities = 21/65 (32%), Positives = 23/65 (35%), Gaps = 1/65 (1%) Frame = +3 Query: 546 GXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXG-GXXXXPPPXPPPXXKKXX 722 G + PP + PPPPPPP P PPP PPP K Sbjct: 24 GGYDYPQPAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTY 83 Query: 723 PPPPP 737 PP P Sbjct: 84 IPPAP 88 Score = 33.5 bits (73), Expect = 0.48 Identities = 21/71 (29%), Positives = 21/71 (29%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP P K I PPPPP P P PP P Sbjct: 45 PPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPPAPAPVAPVETYIPPAAPA 104 Query: 702 PXXKKXXPPPP 734 P PP P Sbjct: 105 P---AYIPPAP 112 Score = 31.9 bits (69), Expect = 1.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 665 GGXXXXXPPPPXPXXKKXXPPPPPP 739 GG P PP P PPPPPP Sbjct: 24 GGYDYPQPAPPAPVKSYIPPPPPPP 48 >AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-PA protein. Length = 1644 Score = 42.7 bits (96), Expect = 8e-04 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPPP P G PPP P PPPPP Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPP 314 Score = 39.5 bits (88), Expect = 0.007 Identities = 18/55 (32%), Positives = 20/55 (36%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP + PPPPPPP P PPP PPP + P P Sbjct: 272 PPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPPSMQMASRPRTP 326 Score = 29.9 bits (64), Expect = 6.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 651 PXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P G PP PPP PPPPP Sbjct: 259 PSQPVGVSAKTTPPPPPPPMAPAAPPPPP 287 >AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-PA protein. Length = 145 Score = 42.7 bits (96), Expect = 8e-04 Identities = 21/65 (32%), Positives = 23/65 (35%), Gaps = 1/65 (1%) Frame = +3 Query: 546 GXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXG-GXXXXPPPXPPPXXKKXX 722 G + PP + PPPPPPP P PPP PPP K Sbjct: 24 GGYDYPQPAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTY 83 Query: 723 PPPPP 737 PP P Sbjct: 84 IPPAP 88 Score = 33.5 bits (73), Expect = 0.48 Identities = 21/71 (29%), Positives = 21/71 (29%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP P K I PPPPP P P PP P Sbjct: 45 PPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPPAPAPVAPVETYIPPAAPA 104 Query: 702 PXXKKXXPPPP 734 P PP P Sbjct: 105 P---AYIPPAP 112 Score = 31.9 bits (69), Expect = 1.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 665 GGXXXXXPPPPXPXXKKXXPPPPPP 739 GG P PP P PPPPPP Sbjct: 24 GGYDYPQPAPPAPVKSYIPPPPPPP 48 >AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. Length = 1644 Score = 42.7 bits (96), Expect = 8e-04 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPPP P G PPP P PPPPP Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPP 314 Score = 39.5 bits (88), Expect = 0.007 Identities = 18/55 (32%), Positives = 20/55 (36%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP + PPPPPPP P PPP PPP + P P Sbjct: 272 PPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPPSMQMASRPRTP 326 Score = 29.9 bits (64), Expect = 6.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 651 PXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P G PP PPP PPPPP Sbjct: 259 PSQPVGVSAKTTPPPPPPPMAPAAPPPPP 287 >AY094861-1|AAM11214.1| 362|Drosophila melanogaster RE22192p protein. Length = 362 Score = 41.5 bits (93), Expect = 0.002 Identities = 24/75 (32%), Positives = 25/75 (33%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPP 689 GGG P G G G PP + PPPP P P G P Sbjct: 144 GGGGQGPGWNGPGWNGGGGRGPPPRPGFNGGGPPPPRPGWNGGGPPPPMPGWNGGG---P 200 Query: 690 PXPPPXXKKXXPPPP 734 P P P PPPP Sbjct: 201 PPPRPGWNGGGPPPP 215 Score = 37.9 bits (84), Expect = 0.022 Identities = 21/63 (33%), Positives = 23/63 (36%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPP 689 GGG PPP G F G PP + + PPPP P P PP Sbjct: 160 GGGRGPPPRPG-----FNGGGPPPPRPGWNGGGPPPPMPGWNGGGPPPPRPGWNGGGPPP 214 Query: 690 PXP 698 P P Sbjct: 215 PRP 217 Score = 32.3 bits (70), Expect = 1.1 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GGGG G + G GGG PPP G GGG Sbjct: 144 GGGGQGPGWNGPGWNGGGGRGPPPRPGFNGGGPPPPRPGWNGGG 187 Score = 30.7 bits (66), Expect = 3.4 Identities = 21/76 (27%), Positives = 24/76 (31%) Frame = -1 Query: 736 GGGGGXXFFXXGGGXGGGXXXXPPXXXXGXXXXXXXXXXXXXXXXXKKIXFFXGGXXPXK 557 GGGG + G GGG PP + + GG P Sbjct: 144 GGGGQGPGWNGPGWNGGGGRGPPPRPGFNGGGPPPPRPGWNGGGPPPPMPGWNGGGPPP- 202 Query: 556 XXXPPPXXGGGGXPPP 509 P P GGG PPP Sbjct: 203 ---PRPGWNGGGPPPP 215 >AE014297-3653|AAF56353.1| 362|Drosophila melanogaster CG7016-PA protein. Length = 362 Score = 41.5 bits (93), Expect = 0.002 Identities = 24/75 (32%), Positives = 25/75 (33%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPP 689 GGG P G G G PP + PPPP P P G P Sbjct: 144 GGGGQGPGWNGPGWNGGGGRGPPPRPGFNGGGPPPPRPGWNGGGPPPPMPGWNGGG---P 200 Query: 690 PXPPPXXKKXXPPPP 734 P P P PPPP Sbjct: 201 PPPRPGWNGGGPPPP 215 Score = 37.9 bits (84), Expect = 0.022 Identities = 21/63 (33%), Positives = 23/63 (36%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPP 689 GGG PPP G F G PP + + PPPP P P PP Sbjct: 160 GGGRGPPPRPG-----FNGGGPPPPRPGWNGGGPPPPMPGWNGGGPPPPRPGWNGGGPPP 214 Query: 690 PXP 698 P P Sbjct: 215 PRP 217 Score = 32.3 bits (70), Expect = 1.1 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GGGG G + G GGG PPP G GGG Sbjct: 144 GGGGQGPGWNGPGWNGGGGRGPPPRPGFNGGGPPPPRPGWNGGG 187 Score = 30.7 bits (66), Expect = 3.4 Identities = 21/76 (27%), Positives = 24/76 (31%) Frame = -1 Query: 736 GGGGGXXFFXXGGGXGGGXXXXPPXXXXGXXXXXXXXXXXXXXXXXKKIXFFXGGXXPXK 557 GGGG + G GGG PP + + GG P Sbjct: 144 GGGGQGPGWNGPGWNGGGGRGPPPRPGFNGGGPPPPRPGWNGGGPPPPMPGWNGGGPPP- 202 Query: 556 XXXPPPXXGGGGXPPP 509 P P GGG PPP Sbjct: 203 ---PRPGWNGGGPPPP 215 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 40.3 bits (90), Expect = 0.004 Identities = 23/72 (31%), Positives = 24/72 (33%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP + PP PPP P G PPP PP Sbjct: 78 PPPPPQPTPPAPRPSYGPPQTQ-------PPRPPPQPTPSAPAPPPPSYGPPQTPPPRPP 130 Query: 702 PXXKKXXPPPPP 737 P P PPP Sbjct: 131 PQPTPSAPAPPP 142 Score = 38.7 bits (86), Expect = 0.013 Identities = 24/76 (31%), Positives = 24/76 (31%), Gaps = 5/76 (6%) Frame = +3 Query: 525 PPPXXGGGXXXFX-GXXPPXKKXIFXXXPP----PPPPPXXXXXXXXPXXXXGGXXXXPP 689 PPP G G G P PP PPPPP P G PP Sbjct: 42 PPPGSGNGIEDSGIGPGPAPSAPAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPP 101 Query: 690 PXPPPXXKKXXPPPPP 737 PP PPPP Sbjct: 102 RPPPQPTPSAPAPPPP 117 Score = 36.3 bits (80), Expect = 0.069 Identities = 29/115 (25%), Positives = 30/115 (26%), Gaps = 3/115 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPP G P PP P P P PPP PP Sbjct: 154 PPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPP 213 Query: 702 PXXKK---XXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 P + PPPPP K G PP P P P P Sbjct: 214 PRPQPTPGYGPPPPP---PPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRP 265 Score = 35.1 bits (77), Expect = 0.16 Identities = 21/84 (25%), Positives = 22/84 (26%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXX 785 PPPPP P P G P P PP PP P S Sbjct: 227 PPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRPQPGSEYLPPPGENEVT 286 Query: 786 XXXPPXXXXXFXFXXXPXPPPXXP 857 P + P PP P Sbjct: 287 PTQPQPTAPVPEYGPPPPAPPAGP 310 Score = 33.9 bits (74), Expect = 0.37 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPP 731 PPP PPP P G PPP PPP P P Sbjct: 125 PPPRPPPQPTPSAPAPPPSY-GPPQTPPPRPPPQPTPSAPAP 165 Score = 33.9 bits (74), Expect = 0.37 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXP-PPXPPPXXKKXXPPPP 734 PP PP P P G P PP PP + PPPP Sbjct: 351 PPAPPAPTYQPQPPAPPAPAPGPTYQPRPPAPPAPTPEYGPPPP 394 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/73 (27%), Positives = 21/73 (28%), Gaps = 1/73 (1%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPP-PPXXXXXXXXPXXXXGGXXXXPPPXP 698 PP P G PP + PPPP P P PP Sbjct: 86 PPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYG 145 Query: 699 PPXXKKXXPPPPP 737 PP PPP P Sbjct: 146 PPQTPPPRPPPQP 158 Score = 32.3 bits (70), Expect = 1.1 Identities = 28/120 (23%), Positives = 29/120 (24%), Gaps = 8/120 (6%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP--------PPPPXXXXXXXXPXXXXGGXX 677 P PP G PP + PPP PP P P G Sbjct: 112 PAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQ 171 Query: 678 XXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PP PP P P K PP P PPP P Sbjct: 172 PQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPP 231 Score = 29.9 bits (64), Expect = 6.0 Identities = 20/72 (27%), Positives = 21/72 (29%), Gaps = 3/72 (4%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXP---PPPPPPXXXXXXXXPXXXXGGXXXXPPP 692 PPPP G PP P PP PPP P PP Sbjct: 209 PPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPP 268 Query: 693 XPPPXXKKXXPP 728 P P + PP Sbjct: 269 RPQPGSEYLPPP 280 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 40.3 bits (90), Expect = 0.004 Identities = 23/72 (31%), Positives = 24/72 (33%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP + PP PPP P G PPP PP Sbjct: 78 PPPPPQPTPPAPRPSYGPPQTQ-------PPRPPPQPTPSAPAPPPPSYGPPQTPPPRPP 130 Query: 702 PXXKKXXPPPPP 737 P P PPP Sbjct: 131 PQPTPSAPAPPP 142 Score = 38.7 bits (86), Expect = 0.013 Identities = 24/76 (31%), Positives = 24/76 (31%), Gaps = 5/76 (6%) Frame = +3 Query: 525 PPPXXGGGXXXFX-GXXPPXKKXIFXXXPP----PPPPPXXXXXXXXPXXXXGGXXXXPP 689 PPP G G G P PP PPPPP P G PP Sbjct: 42 PPPGSGNGIEDSGIGPGPAPSAPAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPP 101 Query: 690 PXPPPXXKKXXPPPPP 737 PP PPPP Sbjct: 102 RPPPQPTPSAPAPPPP 117 Score = 36.3 bits (80), Expect = 0.069 Identities = 29/115 (25%), Positives = 30/115 (26%), Gaps = 3/115 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPP G P PP P P P PPP PP Sbjct: 154 PPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPP 213 Query: 702 PXXKK---XXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 P + PPPPP K G PP P P P P Sbjct: 214 PRPQPTPGYGPPPPP---PPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRP 265 Score = 35.1 bits (77), Expect = 0.16 Identities = 21/84 (25%), Positives = 22/84 (26%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXX 785 PPPPP P P G P P PP PP P S Sbjct: 227 PPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRPQPGSEYLPPPGENEVT 286 Query: 786 XXXPPXXXXXFXFXXXPXPPPXXP 857 P + P PP P Sbjct: 287 PTQPQPTAPVPEYGPPPPAPPAGP 310 Score = 33.9 bits (74), Expect = 0.37 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPP 731 PPP PPP P G PPP PPP P P Sbjct: 125 PPPRPPPQPTPSAPAPPPSY-GPPQTPPPRPPPQPTPSAPAP 165 Score = 33.9 bits (74), Expect = 0.37 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXP-PPXPPPXXKKXXPPPP 734 PP PP P P G P PP PP + PPPP Sbjct: 351 PPAPPAPTYQPQPPAPPAPAPGPTYQPRPPAPPAPTPEYGPPPP 394 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/73 (27%), Positives = 21/73 (28%), Gaps = 1/73 (1%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPP-PPXXXXXXXXPXXXXGGXXXXPPPXP 698 PP P G PP + PPPP P P PP Sbjct: 86 PPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYG 145 Query: 699 PPXXKKXXPPPPP 737 PP PPP P Sbjct: 146 PPQTPPPRPPPQP 158 Score = 32.3 bits (70), Expect = 1.1 Identities = 28/120 (23%), Positives = 29/120 (24%), Gaps = 8/120 (6%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP--------PPPPXXXXXXXXPXXXXGGXX 677 P PP G PP + PPP PP P P G Sbjct: 112 PAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQ 171 Query: 678 XXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PP PP P P K PP P PPP P Sbjct: 172 PQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPP 231 Score = 29.9 bits (64), Expect = 6.0 Identities = 20/72 (27%), Positives = 21/72 (29%), Gaps = 3/72 (4%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXP---PPPPPPXXXXXXXXPXXXXGGXXXXPPP 692 PPPP G PP P PP PPP P PP Sbjct: 209 PPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPP 268 Query: 693 XPPPXXKKXXPP 728 P P + PP Sbjct: 269 RPQPGSEYLPPP 280 >AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p protein. Length = 527 Score = 39.9 bits (89), Expect = 0.006 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPP P P PPP PPP PPPPP Sbjct: 357 PPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPP 400 Score = 35.1 bits (77), Expect = 0.16 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PP PP P G PPP PP PPPP Sbjct: 334 PPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPP 374 Score = 32.3 bits (70), Expect = 1.1 Identities = 18/76 (23%), Positives = 20/76 (26%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPP 689 G PPP PP + PPPPPPP P G Sbjct: 352 GAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIPVITT 411 Query: 690 PXPPPXXKKXXPPPPP 737 P + P P Sbjct: 412 THAPTQAARPAAPAAP 427 Score = 32.3 bits (70), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 382 PPPPPPPPPAAVPPPPPP 399 Score = 32.3 bits (70), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 383 PPPPPPPPAAVPPPPPPP 400 >AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC, isoform C protein. Length = 494 Score = 39.9 bits (89), Expect = 0.006 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPP P P PPP PPP PPPPP Sbjct: 324 PPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPP 367 Score = 35.1 bits (77), Expect = 0.16 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PP PP P G PPP PP PPPP Sbjct: 301 PPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPP 341 Score = 32.3 bits (70), Expect = 1.1 Identities = 18/76 (23%), Positives = 20/76 (26%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPP 689 G PPP PP + PPPPPPP P G Sbjct: 319 GAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIPVITT 378 Query: 690 PXPPPXXKKXXPPPPP 737 P + P P Sbjct: 379 THAPTQAARPAAPAAP 394 Score = 32.3 bits (70), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 349 PPPPPPPPPAAVPPPPPP 366 Score = 32.3 bits (70), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 350 PPPPPPPPAAVPPPPPPP 367 >AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB, isoform B protein. Length = 527 Score = 39.9 bits (89), Expect = 0.006 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPP P P PPP PPP PPPPP Sbjct: 357 PPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPP 400 Score = 35.1 bits (77), Expect = 0.16 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PP PP P G PPP PP PPPP Sbjct: 334 PPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPP 374 Score = 32.3 bits (70), Expect = 1.1 Identities = 18/76 (23%), Positives = 20/76 (26%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPP 689 G PPP PP + PPPPPPP P G Sbjct: 352 GAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIPVITT 411 Query: 690 PXPPPXXKKXXPPPPP 737 P + P P Sbjct: 412 THAPTQAARPAAPAAP 427 Score = 32.3 bits (70), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 382 PPPPPPPPPAAVPPPPPP 399 Score = 32.3 bits (70), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 383 PPPPPPPPAAVPPPPPPP 400 >AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA, isoform A protein. Length = 527 Score = 39.9 bits (89), Expect = 0.006 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPP P P PPP PPP PPPPP Sbjct: 357 PPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPP 400 Score = 35.1 bits (77), Expect = 0.16 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PP PP P G PPP PP PPPP Sbjct: 334 PPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPP 374 Score = 32.3 bits (70), Expect = 1.1 Identities = 18/76 (23%), Positives = 20/76 (26%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPP 689 G PPP PP + PPPPPPP P G Sbjct: 352 GAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIPVITT 411 Query: 690 PXPPPXXKKXXPPPPP 737 P + P P Sbjct: 412 THAPTQAARPAAPAAP 427 Score = 32.3 bits (70), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 382 PPPPPPPPPAAVPPPPPP 399 Score = 32.3 bits (70), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 383 PPPPPPPPAAVPPPPPPP 400 >AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p protein. Length = 993 Score = 39.5 bits (88), Expect = 0.007 Identities = 27/78 (34%), Positives = 28/78 (35%), Gaps = 4/78 (5%) Frame = +3 Query: 516 GXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX 695 G PPPP G G PP + PPPPPP P G PPP Sbjct: 434 GPPPPPPSGN-----YGPPPPPPSGNYG---PPPPPPSGNYGPPPPPS--GNYGPPPPPS 483 Query: 696 ----PPPXXKKXXPPPPP 737 PPP PPPP Sbjct: 484 GNYGPPPPPSGNYGPPPP 501 Score = 35.9 bits (79), Expect = 0.091 Identities = 18/59 (30%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = +3 Query: 576 PXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXX-----PPPXPPPXXKKXXPPPPP 737 P + ++ PPPP P P G PP PPP + PPPPP Sbjct: 601 PSPQALYQPPPPPPSAPQLSLQQQLPAPQPGPAFVHQKQFGPPGPPPPPEPQYLPPPPP 659 Score = 31.9 bits (69), Expect = 1.5 Identities = 20/65 (30%), Positives = 21/65 (32%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXX 785 PPPPPP P G P PPP PPPPP + G Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYG------PPPPPPSGNYGPPPPPS-GNYGPPPPPSGNYG 487 Query: 786 XXXPP 800 PP Sbjct: 488 PPPPP 492 Score = 30.7 bits (66), Expect = 3.4 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPP P P G P P P + PPPP Sbjct: 129 PPPPKPAPQYGPPPQPAPQYGPPPPKPAPQYGPPPTQYGPPPP 171 Score = 30.7 bits (66), Expect = 3.4 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 687 PPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPP 848 PP PPP PPPPP G PP P PPP Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSG------NYGPPPPP 482 >AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA protein. Length = 993 Score = 39.5 bits (88), Expect = 0.007 Identities = 27/78 (34%), Positives = 28/78 (35%), Gaps = 4/78 (5%) Frame = +3 Query: 516 GXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX 695 G PPPP G G PP + PPPPPP P G PPP Sbjct: 434 GPPPPPPSGN-----YGPPPPPPSGNYG---PPPPPPSGNYGPPPPPS--GNYGPPPPPS 483 Query: 696 ----PPPXXKKXXPPPPP 737 PPP PPPP Sbjct: 484 GNYGPPPPPSGNYGPPPP 501 Score = 35.9 bits (79), Expect = 0.091 Identities = 18/59 (30%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = +3 Query: 576 PXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXX-----PPPXPPPXXKKXXPPPPP 737 P + ++ PPPP P P G PP PPP + PPPPP Sbjct: 601 PSPQALYQPPPPPPSAPQLSLQQQLPAPQPGPAFVHQKQFGPPGPPPPPEPQYLPPPPP 659 Score = 31.9 bits (69), Expect = 1.5 Identities = 20/65 (30%), Positives = 21/65 (32%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXX 785 PPPPPP P G P PPP PPPPP + G Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYG------PPPPPPSGNYGPPPPPS-GNYGPPPPPSGNYG 487 Query: 786 XXXPP 800 PP Sbjct: 488 PPPPP 492 Score = 30.7 bits (66), Expect = 3.4 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPP P P G P P P + PPPP Sbjct: 129 PPPPKPAPQYGPPPQPAPQYGPPPPKPAPQYGPPPTQYGPPPP 171 Score = 30.7 bits (66), Expect = 3.4 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 687 PPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPP 848 PP PPP PPPPP G PP P PPP Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSG------NYGPPPPP 482 >BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p protein. Length = 1273 Score = 38.7 bits (86), Expect = 0.013 Identities = 22/72 (30%), Positives = 22/72 (30%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP PP PPPP P PP P Sbjct: 697 PPPPPMPASPTASSAAPPPPPPPA----PPAPPPPPGFSPLGSPSGSLAS-TAPSPPHAP 751 Query: 702 PXXKKXXPPPPP 737 P PPPPP Sbjct: 752 PMLSSFQPPPPP 763 Score = 29.9 bits (64), Expect = 6.0 Identities = 22/79 (27%), Positives = 22/79 (27%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXX 788 PPPPPP P PPP PP PPPP S Sbjct: 696 PPPPPPMPAS----PTASSAAPPPPPPPAPPA-------PPPPPGFSPLGSPSGSLASTA 744 Query: 789 XXPPXXXXXFXFXXXPXPP 845 PP P PP Sbjct: 745 PSPPHAPPMLSSFQPPPPP 763 >BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p protein. Length = 652 Score = 37.5 bits (83), Expect = 0.030 Identities = 44/178 (24%), Positives = 46/178 (25%) Frame = +3 Query: 204 TXFXXKTXXTPXXXPGFXPPXNSPXXXXPXXAGFXXKXPGGXXXQXGVFPPXXXXXPKKX 383 T F TP P PP GF GG GV P PK Sbjct: 455 TGFPGAIPYTPDNGPT-GPPAPPYVHVVGPEGGFGGN--GGKGDGGGV-GPGGPGGPKGP 510 Query: 384 GGEKTPXXXXXXXLXPXXFSPXKKXXXALXKKXXXFXXXXXXGGGXPPPPXXGGGXXXFX 563 GG K P P P K F G PP P G + Sbjct: 511 GGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPG---PYG 567 Query: 564 GXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP PP PP P P G P PP + P P P Sbjct: 568 PPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRPGPPGPTRPGPPGPSP 625 >AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p protein. Length = 268 Score = 36.7 bits (81), Expect = 0.052 Identities = 35/139 (25%), Positives = 37/139 (26%) Frame = +3 Query: 321 GGXXXQXGVFPPXXXXXPKKXGGEKTPXXXXXXXLXPXXFSPXKKXXXALXKKXXXFXXX 500 GG GV P PK GG K P P P K F Sbjct: 107 GGKGDGGGV-GPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPP 165 Query: 501 XXXGGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXX 680 G PP P G + PP PP PP P P G Sbjct: 166 GPPGPPGPPGPTRPG---PYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPG 222 Query: 681 XPPPXPPPXXKKXXPPPPP 737 P PP + P P P Sbjct: 223 PTRPGPPGPTRPGPPGPSP 241 >AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC, isoform C protein. Length = 682 Score = 36.7 bits (81), Expect = 0.052 Identities = 35/139 (25%), Positives = 37/139 (26%) Frame = +3 Query: 321 GGXXXQXGVFPPXXXXXPKKXGGEKTPXXXXXXXLXPXXFSPXKKXXXALXKKXXXFXXX 500 GG GV P PK GG K P P P K F Sbjct: 521 GGKGDGGGV-GPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPP 579 Query: 501 XXXGGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXX 680 G PP P G + PP PP PP P P G Sbjct: 580 GPPGPPGPPGPTRPG---PYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPG 636 Query: 681 XPPPXPPPXXKKXXPPPPP 737 P PP + P P P Sbjct: 637 PTRPGPPGPTRPGPPGPSP 655 >AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB, isoform B protein. Length = 682 Score = 36.7 bits (81), Expect = 0.052 Identities = 35/139 (25%), Positives = 37/139 (26%) Frame = +3 Query: 321 GGXXXQXGVFPPXXXXXPKKXGGEKTPXXXXXXXLXPXXFSPXKKXXXALXKKXXXFXXX 500 GG GV P PK GG K P P P K F Sbjct: 521 GGKGDGGGV-GPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPP 579 Query: 501 XXXGGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXX 680 G PP P G + PP PP PP P P G Sbjct: 580 GPPGPPGPPGPTRPG---PYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPG 636 Query: 681 XPPPXPPPXXKKXXPPPPP 737 P PP + P P P Sbjct: 637 PTRPGPPGPTRPGPPGPSP 655 >AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD, isoform D protein. Length = 268 Score = 36.7 bits (81), Expect = 0.052 Identities = 35/139 (25%), Positives = 37/139 (26%) Frame = +3 Query: 321 GGXXXQXGVFPPXXXXXPKKXGGEKTPXXXXXXXLXPXXFSPXKKXXXALXKKXXXFXXX 500 GG GV P PK GG K P P P K F Sbjct: 107 GGKGDGGGV-GPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPP 165 Query: 501 XXXGGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXX 680 G PP P G + PP PP PP P P G Sbjct: 166 GPPGPPGPPGPTRPG---PYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPG 222 Query: 681 XPPPXPPPXXKKXXPPPPP 737 P PP + P P P Sbjct: 223 PTRPGPPGPTRPGPPGPSP 241 >AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA, isoform A protein. Length = 268 Score = 36.7 bits (81), Expect = 0.052 Identities = 35/139 (25%), Positives = 37/139 (26%) Frame = +3 Query: 321 GGXXXQXGVFPPXXXXXPKKXGGEKTPXXXXXXXLXPXXFSPXKKXXXALXKKXXXFXXX 500 GG GV P PK GG K P P P K F Sbjct: 107 GGKGDGGGV-GPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPP 165 Query: 501 XXXGGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXX 680 G PP P G + PP PP PP P P G Sbjct: 166 GPPGPPGPPGPTRPG---PYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPG 222 Query: 681 XPPPXPPPXXKKXXPPPPP 737 P PP + P P P Sbjct: 223 PTRPGPPGPTRPGPPGPSP 241 >AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-PA, isoform A protein. Length = 1393 Score = 27.5 bits (58), Expect(2) = 0.077 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 576 PXKKXIFXXXPPPPPPP 626 P KK PPPPPPP Sbjct: 650 PVKKPAAAPPPPPPPPP 666 Score = 27.5 bits (58), Expect(2) = 0.077 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 658 PPPPPPP---PPPPPPPP 672 >AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p protein. Length = 1294 Score = 27.5 bits (58), Expect(2) = 0.078 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 576 PXKKXIFXXXPPPPPPP 626 P KK PPPPPPP Sbjct: 650 PVKKPAAAPPPPPPPPP 666 Score = 27.5 bits (58), Expect(2) = 0.078 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 658 PPPPPPP---PPPPPPPP 672 >AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-PB, isoform B protein. Length = 1294 Score = 27.5 bits (58), Expect(2) = 0.078 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 576 PXKKXIFXXXPPPPPPP 626 P KK PPPPPPP Sbjct: 650 PVKKPAAAPPPPPPPPP 666 Score = 27.5 bits (58), Expect(2) = 0.078 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 658 PPPPPPP---PPPPPPPP 672 >AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p protein. Length = 1211 Score = 27.5 bits (58), Expect(2) = 0.078 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 576 PXKKXIFXXXPPPPPPP 626 P KK PPPPPPP Sbjct: 468 PVKKPAAAPPPPPPPPP 484 Score = 27.5 bits (58), Expect(2) = 0.078 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 476 PPPPPPP---PPPPPPPP 490 >AE014296-2355|AAF49762.2| 1155|Drosophila melanogaster CG32138-PB, isoform B protein. Length = 1155 Score = 35.5 bits (78), Expect = 0.12 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP PPPP P PP PP PPPPP Sbjct: 613 PPAPPPPPGFSPLGSPSGSLAS-TAPSPPHAPPMLSSFQPPPPP 655 >AE014296-2354|AAF49761.2| 1165|Drosophila melanogaster CG32138-PA, isoform A protein. Length = 1165 Score = 35.5 bits (78), Expect = 0.12 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP PPPP P PP PP PPPPP Sbjct: 613 PPAPPPPPGFSPLGSPSGSLAS-TAPSPPHAPPMLSSFQPPPPP 655 >AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p protein. Length = 417 Score = 34.7 bits (76), Expect = 0.21 Identities = 26/81 (32%), Positives = 26/81 (32%), Gaps = 5/81 (6%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP---PPPXXXXXXXXPXXXXGGXXXXPPP 692 PPPP G PP PPPP PP GG PPP Sbjct: 343 PPPPATEPLNPPIPGTLPPL-------IPPPPGTSAPPMPPWGGGAYSGWGGGYAPPPPP 395 Query: 693 X--PPPXXKKXXPPPPPXXXS 749 PPP PPPP S Sbjct: 396 PCAPPPPALSLSQPPPPPPPS 416 >AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p protein. Length = 222 Score = 34.7 bits (76), Expect = 0.21 Identities = 26/81 (32%), Positives = 26/81 (32%), Gaps = 5/81 (6%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP---PPPXXXXXXXXPXXXXGGXXXXPPP 692 PPPP G PP PPPP PP GG PPP Sbjct: 148 PPPPATEPLNPPIPGTLPPL-------IPPPPGTSAPPMPPWGGGAYSGWGGGYAPPPPP 200 Query: 693 X--PPPXXKKXXPPPPPXXXS 749 PPP PPPP S Sbjct: 201 PCAPPPPALSLSQPPPPPPPS 221 >AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 protein. Length = 809 Score = 34.7 bits (76), Expect = 0.21 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPP 704 PPPPPPP P PPP PPP Sbjct: 648 PPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPP 680 Score = 34.3 bits (75), Expect = 0.28 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPPPP P P P PPP PPPP Sbjct: 645 PPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPP------PPPP 681 Score = 33.1 bits (72), Expect = 0.64 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPPP P PP PP PPPPP Sbjct: 642 PPPPPPP------PPPPPPQTCCAPVRPPYAPPVRPLPPPPPPP 679 Score = 31.9 bits (69), Expect = 1.5 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPPP P PPP PPP P P Sbjct: 649 PPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYPYTPIYP 691 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPP 626 PPPP PP + PPPPPPP Sbjct: 646 PPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPP 680 >AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB, isoform B protein. Length = 887 Score = 34.7 bits (76), Expect = 0.21 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPP 704 PPPPPPP P PPP PPP Sbjct: 788 PPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPP 820 Score = 34.3 bits (75), Expect = 0.28 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPPPP P P P PPP PPPP Sbjct: 785 PPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPP------PPPP 821 Score = 33.1 bits (72), Expect = 0.64 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPPP P PP PP PPPPP Sbjct: 782 PPPPPPP------PPPPPPQTCCAPVRPPYAPPVRPLPPPPPPP 819 Score = 31.9 bits (69), Expect = 1.5 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPPP P PPP PPP P P Sbjct: 789 PPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYPYTPIYP 831 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPP 626 PPPP PP + PPPPPPP Sbjct: 786 PPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPP 820 >AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA protein. Length = 787 Score = 34.7 bits (76), Expect = 0.21 Identities = 26/81 (32%), Positives = 26/81 (32%), Gaps = 5/81 (6%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP---PPPXXXXXXXXPXXXXGGXXXXPPP 692 PPPP G PP PPPP PP GG PPP Sbjct: 713 PPPPATEPLNPPIPGTLPPL-------IPPPPGTSAPPMPPWGGGAYSGWGGGYAPPPPP 765 Query: 693 X--PPPXXKKXXPPPPPXXXS 749 PPP PPPP S Sbjct: 766 PCAPPPPALSLSQPPPPPPPS 786 >AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA protein. Length = 579 Score = 34.7 bits (76), Expect = 0.21 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPPP PPP PPP + PPPPP Sbjct: 463 PPPPPPPPP-----------------PPPPPPPPTEPPPPPPPP 489 Score = 33.1 bits (72), Expect = 0.64 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P + PPPPPP Sbjct: 472 PPPPPPPPTEPPPPPPPP 489 Score = 33.1 bits (72), Expect = 0.64 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P + PPPPPP Sbjct: 473 PPPPPPPTEPPPPPPPPP 490 Score = 32.3 bits (70), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 470 PPPPPPPPPPTEPPPPPP 487 Score = 32.3 bits (70), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 471 PPPPPPPPPTEPPPPPPP 488 Score = 29.5 bits (63), Expect = 7.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPP 736 PPPP P PPPPP Sbjct: 463 PPPPPPPPPPPPPPPPP 479 Score = 29.5 bits (63), Expect = 7.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP P PPPPPP Sbjct: 463 PPPPPPPPPPPPPPPPP 479 >AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA protein. Length = 237 Score = 34.7 bits (76), Expect = 0.21 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GGGGGG F G GGG G GGGGGG Sbjct: 174 GGGGGGGFGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGG 217 Score = 31.1 bits (67), Expect = 2.6 Identities = 19/63 (30%), Positives = 20/63 (31%) Frame = -1 Query: 871 FXXXXGXXGGGXGXXXKXXXXXXXGGXXXXXXPPXXFXXXXXXXXGGGGGXXFFXXGGGX 692 F G GGG G + G F GGGGG F GG Sbjct: 168 FTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGG 227 Query: 691 GGG 683 GGG Sbjct: 228 GGG 230 Score = 29.9 bits (64), Expect = 6.0 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 736 GGGGGXXFFXXGGGXGGG 683 GGGGG F GGG GGG Sbjct: 21 GGGGGRGFGGGGGGRGGG 38 >BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p protein. Length = 592 Score = 34.3 bits (75), Expect = 0.28 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP PP P G PPP PPP PPPPP Sbjct: 212 PPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPP-----PPPPPP 249 Score = 32.7 bits (71), Expect = 0.84 Identities = 23/76 (30%), Positives = 23/76 (30%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPP 689 G PP P G PP PPPPPPP P PP Sbjct: 208 GSKGPPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPP-------YPYPP 260 Query: 690 PXPPPXXKKXXPPPPP 737 P P P P P P Sbjct: 261 PGPYPGPWIPLPVPVP 276 Score = 32.3 bits (70), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 152 PPPPPPPPPPPPPPPPPP 169 Score = 32.3 bits (70), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 152 PPPPPPPPPPPPPPPPPP 169 Score = 30.3 bits (65), Expect = 4.5 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPP 731 PPPPPPP P PP PP PP Sbjct: 154 PPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPP 195 Score = 29.5 bits (63), Expect = 7.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPPXXXS 749 P P PPP PPPPP S Sbjct: 150 PAPPPPPPPPPPPPPPPPPPHS 171 >AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA protein. Length = 594 Score = 34.3 bits (75), Expect = 0.28 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP PP P G PPP PPP PPPPP Sbjct: 214 PPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPP-----PPPPPP 251 Score = 32.7 bits (71), Expect = 0.84 Identities = 23/76 (30%), Positives = 23/76 (30%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPP 689 G PP P G PP PPPPPPP P PP Sbjct: 210 GSKGPPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPP-------YPYPP 262 Query: 690 PXPPPXXKKXXPPPPP 737 P P P P P P Sbjct: 263 PGPYPGPWIPLPVPVP 278 Score = 32.3 bits (70), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 154 PPPPPPPPPPPPPPPPPP 171 Score = 32.3 bits (70), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 154 PPPPPPPPPPPPPPPPPP 171 Score = 30.3 bits (65), Expect = 4.5 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPP 731 PPPPPPP P PP PP PP Sbjct: 156 PPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPP 197 Score = 29.5 bits (63), Expect = 7.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPPXXXS 749 P P PPP PPPPP S Sbjct: 152 PAPPPPPPPPPPPPPPPPPPHS 173 >X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin protein. Length = 147 Score = 33.9 bits (74), Expect = 0.37 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -3 Query: 758 FXXRXXXGGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 F R GGGGGG F G GGG G GGGG G Sbjct: 29 FRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRG 79 Score = 29.9 bits (64), Expect = 6.0 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 736 GGGGGXXFFXXGGGXGGG 683 GGGGG F GGG GGG Sbjct: 22 GGGGGGGFRGRGGGGGGG 39 >BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p protein. Length = 331 Score = 33.9 bits (74), Expect = 0.37 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -3 Query: 758 FXXRXXXGGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 F R GGGGGG F G GGG G GGG GG Sbjct: 22 FRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGAFGGRGGGGGRGG 72 Score = 29.9 bits (64), Expect = 6.0 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 736 GGGGGXXFFXXGGGXGGG 683 GGGGG F GGG GGG Sbjct: 15 GGGGGGGFRGRGGGGGGG 32 >AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA protein. Length = 344 Score = 33.9 bits (74), Expect = 0.37 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -3 Query: 758 FXXRXXXGGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 F R GGGGGG F G GGG G GGGG G Sbjct: 22 FRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRG 72 Score = 29.9 bits (64), Expect = 6.0 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 736 GGGGGXXFFXXGGGXGGG 683 GGGGG F GGG GGG Sbjct: 15 GGGGGGGFRGRGGGGGGG 32 >AE014296-862|AAF47912.1| 707|Drosophila melanogaster CG13722-PA protein. Length = 707 Score = 33.5 bits (73), Expect = 0.48 Identities = 25/89 (28%), Positives = 27/89 (30%), Gaps = 5/89 (5%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPP--PXPPP--XXKKXXPPPPPXXXSXXKXXXXG 773 P PPPPP P G P P PPP +K PP P K Sbjct: 203 PAPPPPPPPTKKYLPPPQVKQGYDYPKPAIPFPPPTNPPQKYLPPVVPTSPPVPKYVPPP 262 Query: 774 GXXXXXXPP-XXXXXFXFXXXPXPPPXXP 857 PP + P PPP P Sbjct: 263 TPTYIPPPPKKQGYDYPKPAIPFPPPTAP 291 Score = 29.9 bits (64), Expect = 6.0 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +3 Query: 573 PPXKKXIFXXXPP--PPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPP 731 PP K + P P PPP P PP PPP KK PPP Sbjct: 169 PPQVKQGYDYPKPAIPFPPPTAPPQKYLPPVTT----TPAPPPPPPPTKKYLPPP 219 Score = 29.5 bits (63), Expect = 7.9 Identities = 17/57 (29%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +3 Query: 573 PPXKKXIFXXXPP--PPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP K + P PPPP P P PP PPPPP Sbjct: 253 PPVPKYVPPPTPTYIPPPPKKQGYDYPKPAIPFPPPTAPPQKYLPPVTTTQAPPPPP 309 >BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p protein. Length = 538 Score = 33.1 bits (72), Expect = 0.64 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GG GGG F G GG P P G G GGGG Sbjct: 303 GGQGGGGGFGGGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGGGG 346 Score = 30.7 bits (66), Expect = 3.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GG GGG F G GG P P G GGG G Sbjct: 369 GGQGGGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAG 412 Score = 30.7 bits (66), Expect = 3.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GG GGG F G GG P P G G GG G Sbjct: 429 GGQGGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAG 472 Score = 29.5 bits (63), Expect = 7.9 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -3 Query: 734 GGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GG GG + G GG P P G GGG GG Sbjct: 271 GGAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGG 313 >BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p protein. Length = 1011 Score = 33.1 bits (72), Expect = 0.64 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PP + PPPPPP P G PP PP + P PP Sbjct: 586 PPPAPPMLKAIPPPPPPMAPSMMPPPPPPCPGA-----PPPPPSMAQTMAPAPP 634 Score = 32.7 bits (71), Expect = 0.84 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 597 PPPPPPMAPSMMPPPPPP 614 Score = 31.5 bits (68), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP P K PPPPPP Sbjct: 586 PPPAPPMLKAIPPPPPP 602 Score = 30.3 bits (65), Expect = 4.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 664 GGGGXXXPPPXXPXXKKKXPPPPP 735 G G PPP P K PPPPP Sbjct: 579 GCNGAVSPPPAPPMLKAIPPPPPP 602 >AY118781-1|AAM50641.1| 117|Drosophila melanogaster GH13168p protein. Length = 117 Score = 33.1 bits (72), Expect = 0.64 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = -3 Query: 734 GGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GGGGG ++ G GGG P G GGGGGG Sbjct: 58 GGGGGGYYNGGGGGGGGRR----PVYSGNFGPGYGNGGGGGGG 96 >AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p protein. Length = 1114 Score = 33.1 bits (72), Expect = 0.64 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PP + PPPPPP P G PP PP + P PP Sbjct: 547 PPPAPPMLKAIPPPPPPMAPSMMPPPPPPCPGA-----PPPPPSMAQTMAPAPP 595 Score = 32.7 bits (71), Expect = 0.84 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 558 PPPPPPMAPSMMPPPPPP 575 Score = 31.5 bits (68), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP P K PPPPPP Sbjct: 547 PPPAPPMLKAIPPPPPP 563 Score = 30.3 bits (65), Expect = 4.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 664 GGGGXXXPPPXXPXXKKKXPPPPP 735 G G PPP P K PPPPP Sbjct: 540 GCNGAVSPPPAPPMLKAIPPPPPP 563 >AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 protein. Length = 979 Score = 33.1 bits (72), Expect = 0.64 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PP + PPPPPP P G PP PP + P PP Sbjct: 392 PPPAPPMLKAIPPPPPPMAPSMMPPPPPPCPGA-----PPPPPSMAQTMAPAPP 440 Score = 32.7 bits (71), Expect = 0.84 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 403 PPPPPPMAPSMMPPPPPP 420 Score = 31.5 bits (68), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP P K PPPPPP Sbjct: 392 PPPAPPMLKAIPPPPPP 408 Score = 30.3 bits (65), Expect = 4.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 664 GGGGXXXPPPXXPXXKKKXPPPPP 735 G G PPP P K PPPPP Sbjct: 385 GCNGAVSPPPAPPMLKAIPPPPPP 408 >AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA, isoform A protein. Length = 1114 Score = 33.1 bits (72), Expect = 0.64 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PP + PPPPPP P G PP PP + P PP Sbjct: 547 PPPAPPMLKAIPPPPPPMAPSMMPPPPPPCPGA-----PPPPPSMAQTMAPAPP 595 Score = 32.7 bits (71), Expect = 0.84 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 558 PPPPPPMAPSMMPPPPPP 575 Score = 31.5 bits (68), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP P K PPPPPP Sbjct: 547 PPPAPPMLKAIPPPPPP 563 Score = 30.3 bits (65), Expect = 4.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 664 GGGGXXXPPPXXPXXKKKXPPPPP 735 G G PPP P K PPPPP Sbjct: 540 GCNGAVSPPPAPPMLKAIPPPPPP 563 >AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB, isoform B protein. Length = 1153 Score = 33.1 bits (72), Expect = 0.64 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PP + PPPPPP P G PP PP + P PP Sbjct: 586 PPPAPPMLKAIPPPPPPMAPSMMPPPPPPCPGA-----PPPPPSMAQTMAPAPP 634 Score = 32.7 bits (71), Expect = 0.84 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 597 PPPPPPMAPSMMPPPPPP 614 Score = 31.5 bits (68), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP P K PPPPPP Sbjct: 586 PPPAPPMLKAIPPPPPP 602 Score = 30.3 bits (65), Expect = 4.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 664 GGGGXXXPPPXXPXXKKKXPPPPP 735 G G PPP P K PPPPP Sbjct: 579 GCNGAVSPPPAPPMLKAIPPPPPP 602 >AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC, isoform C protein. Length = 1455 Score = 33.1 bits (72), Expect = 0.64 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PP + PPPPPP P G PP PP + P PP Sbjct: 888 PPPAPPMLKAIPPPPPPMAPSMMPPPPPPCPGA-----PPPPPSMAQTMAPAPP 936 Score = 32.7 bits (71), Expect = 0.84 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 899 PPPPPPMAPSMMPPPPPP 916 Score = 31.5 bits (68), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP P K PPPPPP Sbjct: 888 PPPAPPMLKAIPPPPPP 904 Score = 30.3 bits (65), Expect = 4.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 664 GGGGXXXPPPXXPXXKKKXPPPPP 735 G G PPP P K PPPPP Sbjct: 881 GCNGAVSPPPAPPMLKAIPPPPPP 904 >AE014297-3096|AAF55954.1| 117|Drosophila melanogaster CG5778-PA protein. Length = 117 Score = 33.1 bits (72), Expect = 0.64 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = -3 Query: 734 GGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GGGGG ++ G GGG P G GGGGGG Sbjct: 58 GGGGGGYYNGGGGGGGGRR----PVYSGNFGPGYGNGGGGGGG 96 >AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-PA, isoform A protein. Length = 610 Score = 33.1 bits (72), Expect = 0.64 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GG GGG F G GG P P G G GGGG Sbjct: 375 GGQGGGGGFGGGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGGGG 418 Score = 30.7 bits (66), Expect = 3.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GG GGG F G GG P P G GGG G Sbjct: 441 GGQGGGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAG 484 Score = 30.7 bits (66), Expect = 3.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GG GGG F G GG P P G G GG G Sbjct: 501 GGQGGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAG 544 Score = 29.5 bits (63), Expect = 7.9 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -3 Query: 734 GGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GG GG + G GG P P G GGG GG Sbjct: 343 GGAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGG 385 >U18130-1|AAC46512.1| 1047|Drosophila melanogaster masquerade protein. Length = 1047 Score = 32.7 bits (71), Expect = 0.84 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPP-XPPPXXKKXXP----PPPP 737 P PPPPP P PPP PPP P PPPP Sbjct: 588 PAPPPPPIGPPQAYPPQTPPYSYMNNPPPQGPPPQMAPHHPNPYQPPPP 636 >BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p protein. Length = 207 Score = 32.7 bits (71), Expect = 0.84 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPP P PP PPP PPP P Sbjct: 61 PPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPP---SAPPPPDP 101 Score = 30.7 bits (66), Expect = 3.4 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPPP P P PP PPPP Sbjct: 58 PPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPP 99 Score = 29.9 bits (64), Expect = 6.0 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P PPP P P P P P PPPPP Sbjct: 50 PAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPP 93 >BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p protein. Length = 207 Score = 32.7 bits (71), Expect = 0.84 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPP P PP PPP PPP P Sbjct: 61 PPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPP---SAPPPPDP 101 Score = 30.7 bits (66), Expect = 3.4 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPPP P P PP PPPP Sbjct: 58 PPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPP 99 Score = 29.9 bits (64), Expect = 6.0 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P PPP P P P P P PPPPP Sbjct: 50 PAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPP 93 >BT016106-1|AAV36991.1| 840|Drosophila melanogaster LD20133p protein. Length = 840 Score = 32.7 bits (71), Expect = 0.84 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GGGGGG G GGG P G GGGGGG Sbjct: 99 GGGGGGGVIGGGGMPGGGMMVTPTSTPRG----GANMQGGGGGG 138 >BT001597-1|AAN71352.1| 1047|Drosophila melanogaster RE29416p protein. Length = 1047 Score = 32.7 bits (71), Expect = 0.84 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPP-XPPPXXKKXXP----PPPP 737 P PPPPP P PPP PPP P PPPP Sbjct: 588 PAPPPPPIGPPQAYPPQTPPYSYMNNPPPQGPPPQMAPHHPNPYQPPPP 636 >AY052044-1|AAK93468.1| 581|Drosophila melanogaster LP06006p protein. Length = 581 Score = 32.7 bits (71), Expect = 0.84 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPP-XPPPXXKKXXP----PPPP 737 P PPPPP P PPP PPP P PPPP Sbjct: 122 PAPPPPPIGPPQAYPPQTPPYSYMNNPPPQGPPPQMAPHHPNPYQPPPP 170 >AE014298-1168|AAF46366.1| 926|Drosophila melanogaster CG10555-PA protein. Length = 926 Score = 32.7 bits (71), Expect = 0.84 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GGGGGG G GGG P G GGGGGG Sbjct: 99 GGGGGGGVIGGGGMPGGGMMVTPTSTPRG----GANMQGGGGGG 138 Score = 31.9 bits (69), Expect = 1.5 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +3 Query: 606 PPP---PPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPP PPPP P PP PP ++ PP PP Sbjct: 532 PPPGAYPPPPGSQQVPPVPGQQQPPPGPPPPGQPPTGGQQQPPPGPP 578 Score = 30.7 bits (66), Expect = 3.4 Identities = 24/79 (30%), Positives = 27/79 (34%), Gaps = 4/79 (5%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXI----FXXXPPPPPPPXXXXXXXXPXXXXGGXX 677 G G P G G PP + + PPP PPP P G Sbjct: 519 GHGYQPNAGAGQGPPPGAYPPPPGSQQVPPVPGQQQPPPGPPP--------PGQPPTGGQ 570 Query: 678 XXPPPXPPPXXKKXXPPPP 734 PPP PP + PPPP Sbjct: 571 QQPPPGPP--QSQYGPPPP 587 >AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-PA protein. Length = 926 Score = 32.7 bits (71), Expect = 0.84 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP + PPP PP P P PPP P PPP Sbjct: 307 PPVTTRLPPPPPPPRTPPPTRPPTKPPTTRPPATYLPPTNKPPPPVTTRRPTPPP 361 Score = 32.3 bits (70), Expect = 1.1 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPP--PPP 737 PP PPP PP P PPP PP PP PPP Sbjct: 521 PPPTVRTTRPPPPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPPTPPPTRPPP 577 Score = 31.9 bits (69), Expect = 1.5 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP + PPP PP P P P P PPPPP Sbjct: 221 PPVTTRLPPPPPPPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPP 275 Score = 31.9 bits (69), Expect = 1.5 Identities = 22/86 (25%), Positives = 22/86 (25%), Gaps = 2/86 (2%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP--PXXKKXXPPPPPXXXSXXKXXXXGGX 779 PPP PP P PPP P PPPPP S Sbjct: 323 PPPTRPPTKPPTTRPPATYLPPTNKPPPPVTTRRPTPPPTRPPPPPTRASTPAPTYLPPT 382 Query: 780 XXXXXPPXXXXXFXFXXXPXPPPXXP 857 P P PPP P Sbjct: 383 NKPLPPVTVRTTVRTTPRPTPPPTKP 408 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = +3 Query: 606 PPPPP--PPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPP----PPPXXXS 749 PPPPP PP P PPP PP PP PPP S Sbjct: 530 PPPPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPPTPPPTRPPPPPTRAS 583 Score = 29.9 bits (64), Expect = 6.0 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPP--PP 737 PP + PP PPP P PPP PPP PP PP Sbjct: 193 PPTRPPTRPPTRPPTPPPTYLPPTNKPLPPV--TTRLPPPPPPPRTPPPTRPPTRPP 247 Score = 29.9 bits (64), Expect = 6.0 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 4/48 (8%) Frame = +3 Query: 606 PPPPP----PPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPP PP P P P P PPPPP Sbjct: 271 PPPPPSPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPP 318 Score = 29.5 bits (63), Expect = 7.9 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +3 Query: 606 PPPPPP--PXXXXXXXXPXXXXGGXXXXPP---PXPPPXXKKXXPPPPP 737 PPPPPP P P PP P PP + PPP P Sbjct: 229 PPPPPPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPSP 277 Score = 29.5 bits (63), Expect = 7.9 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +3 Query: 606 PPPPPP--PXXXXXXXXPXXXXGGXXXXPP---PXPPPXXKKXXPPPPP 737 PPPP P P P PP P PP + PPPPP Sbjct: 272 PPPPSPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPPP 320 Score = 29.5 bits (63), Expect = 7.9 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPP 728 PP PPP PP P PPP PP PP Sbjct: 629 PPPSVRTTRPPPPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPPTYPP 680 >AE014296-779|AAF47850.1| 1047|Drosophila melanogaster CG15002-PB protein. Length = 1047 Score = 32.7 bits (71), Expect = 0.84 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPP-XPPPXXKKXXP----PPPP 737 P PPPPP P PPP PPP P PPPP Sbjct: 588 PAPPPPPIGPPQAYPPQTPPYSYMNNPPPQGPPPQMAPHHPNPYQPPPP 636 >AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA protein. Length = 1118 Score = 32.7 bits (71), Expect = 0.84 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPP P PP PPP PPP P Sbjct: 43 PPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPP---SAPPPPDP 83 Score = 30.7 bits (66), Expect = 3.4 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPPP P P PP PPPP Sbjct: 40 PPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPP 81 Score = 29.9 bits (64), Expect = 6.0 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P PPP P P P P P PPPPP Sbjct: 32 PAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPP 75 >BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p protein. Length = 1777 Score = 32.3 bits (70), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 1282 PPPPLPLTPPAAPPPPPP 1299 >AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-PA protein. Length = 1837 Score = 32.3 bits (70), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 1342 PPPPLPLTPPAAPPPPPP 1359 >AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-PA protein. Length = 290 Score = 32.3 bits (70), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 73 PPPPPPPPPPPPPPPPPP 90 Score = 32.3 bits (70), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 73 PPPPPPPPPPPPPPPPPP 90 Score = 32.3 bits (70), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 74 PPPPPPPPPPPPPPPPPP 91 Score = 32.3 bits (70), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 74 PPPPPPPPPPPPPPPPPP 91 >BT016087-1|AAV36972.1| 749|Drosophila melanogaster LD41296p protein. Length = 749 Score = 31.9 bits (69), Expect = 1.5 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPP---PXPPPXXKKXXPPPPP 737 P PPP P G PP P PP PPPPP Sbjct: 526 PAPPPGMPQMHPHPGHPPPGHSLMPPHMGPHQPPPGMPGLPPPPP 570 Score = 29.5 bits (63), Expect = 7.9 Identities = 17/63 (26%), Positives = 18/63 (28%) Frame = +3 Query: 516 GXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX 695 G P PP G PP + P PPP P PP Sbjct: 524 GGPAPPPGMPQMHPHPGHPPPGHSLMPPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHG 583 Query: 696 PPP 704 PPP Sbjct: 584 PPP 586 >BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p protein. Length = 478 Score = 31.9 bits (69), Expect = 1.5 Identities = 21/70 (30%), Positives = 22/70 (31%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 P P GG PP P PPPPP GG PPP P Sbjct: 209 PDPMPPVGGVMVMPSPTPPPPAGGVLVMPRPPPPP----------PPAGGVLVMPPPPPS 258 Query: 702 PXXKKXXPPP 731 + PPP Sbjct: 259 FTPAEVAPPP 268 Score = 31.5 bits (68), Expect = 1.9 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP + P PPPP P PPP PP PPPPP Sbjct: 213 PPVGGVMVMPSPTPPPPAGGVLVMPRP----------PPPPPPAGGVLVMPPPPP 257 >BT003186-1|AAO24941.1| 756|Drosophila melanogaster RE65015p protein. Length = 756 Score = 31.9 bits (69), Expect = 1.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 594 FXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPP 728 F PPPPPPP G PPP PP PP Sbjct: 100 FQVLPPPPPPPQPQSGKNGTQ----GASAAPPPPPPQQPSTLAPP 140 >AY128472-1|AAM75065.1| 836|Drosophila melanogaster RE28238p protein. Length = 836 Score = 31.9 bits (69), Expect = 1.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 594 FXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPP 728 F PPPPPPP G PPP PP PP Sbjct: 177 FQVLPPPPPPPQPQSGKNGTQ----GASAAPPPPPPQQPSTLAPP 217 >AY122174-1|AAM52686.1| 877|Drosophila melanogaster LD34142p protein. Length = 877 Score = 31.9 bits (69), Expect = 1.5 Identities = 23/74 (31%), Positives = 24/74 (32%), Gaps = 1/74 (1%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXG-XXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXP 686 G G PP GGG G PP PP PPP P GG P Sbjct: 148 GPGPPPHYGGGGGGGGHMGMRGPPPPAPHLRGMPPGGPPP-----TQQPGGAGGGGGPPP 202 Query: 687 PPXPPPXXKKXXPP 728 P P + PP Sbjct: 203 PYGQYPAMQHWRPP 216 Score = 30.7 bits (66), Expect = 3.4 Identities = 21/76 (27%), Positives = 23/76 (30%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPP 689 G G PPPP PP P P P P G P Sbjct: 334 GPGPPPPPSQQ------QPQAPPMGMQRGSSVPNGPMSPMENGPPPPPYLRHNGSGYNPG 387 Query: 690 PXPPPXXKKXXPPPPP 737 PPP ++ PPP P Sbjct: 388 APPPPPQQQPQPPPNP 403 Score = 29.5 bits (63), Expect = 7.9 Identities = 15/49 (30%), Positives = 18/49 (36%) Frame = +3 Query: 591 IFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 ++ P PPPPP P G P P + PPPPP Sbjct: 330 LYGPGPGPPPPPSQQQPQAPPMGMQRGSSV---PNGPMSPMENGPPPPP 375 >AY051669-1|AAK93093.1| 457|Drosophila melanogaster LD22190p protein. Length = 457 Score = 31.9 bits (69), Expect = 1.5 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPP---PXPPPXXKKXXPPPPP 737 P PPP P G PP P PP PPPPP Sbjct: 234 PAPPPGMPQMHPHPGHPPPGHSLMPPHMGPHQPPPGMPGLPPPPP 278 Score = 29.5 bits (63), Expect = 7.9 Identities = 17/63 (26%), Positives = 18/63 (28%) Frame = +3 Query: 516 GXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX 695 G P PP G PP + P PPP P PP Sbjct: 232 GGPAPPPGMPQMHPHPGHPPPGHSLMPPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHG 291 Query: 696 PPP 704 PPP Sbjct: 292 PPP 294 >AJ002520-1|CAC20093.1| 749|Drosophila melanogaster DALAO protein protein. Length = 749 Score = 31.9 bits (69), Expect = 1.5 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPP---PXPPPXXKKXXPPPPP 737 P PPP P G PP P PP PPPPP Sbjct: 526 PAPPPGMPQMHPHPGHPPPGHSLMPPHMGPHQPPPGMPGLPPPPP 570 Score = 29.5 bits (63), Expect = 7.9 Identities = 17/63 (26%), Positives = 18/63 (28%) Frame = +3 Query: 516 GXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX 695 G P PP G PP + P PPP P PP Sbjct: 524 GGPAPPPGMPQMHPHPGHPPPGHSLMPPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHG 583 Query: 696 PPP 704 PPP Sbjct: 584 PPP 586 >AF348329-1|AAK31343.1| 749|Drosophila melanogaster Brahma-associated protein 111kD protein. Length = 749 Score = 31.9 bits (69), Expect = 1.5 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPP---PXPPPXXKKXXPPPPP 737 P PPP P G PP P PP PPPPP Sbjct: 526 PAPPPGMPQMHPHPGHPPPGHSLMPPHMGPHQPPPGMPGLPPPPP 570 Score = 29.5 bits (63), Expect = 7.9 Identities = 17/63 (26%), Positives = 18/63 (28%) Frame = +3 Query: 516 GXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX 695 G P PP G PP + P PPP P PP Sbjct: 524 GGPAPPPGMPQMHPHPGHPPPGHSLMPPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHG 583 Query: 696 PPP 704 PPP Sbjct: 584 PPP 586 >AE014298-1284|AAF46450.1| 749|Drosophila melanogaster CG7055-PA protein. Length = 749 Score = 31.9 bits (69), Expect = 1.5 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPP---PXPPPXXKKXXPPPPP 737 P PPP P G PP P PP PPPPP Sbjct: 526 PAPPPGMPQMHPHPGHPPPGHSLMPPHMGPHQPPPGMPGLPPPPP 570 Score = 29.5 bits (63), Expect = 7.9 Identities = 17/63 (26%), Positives = 18/63 (28%) Frame = +3 Query: 516 GXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX 695 G P PP G PP + P PPP P PP Sbjct: 524 GGPAPPPGMPQMHPHPGHPPPGHSLMPPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHG 583 Query: 696 PPP 704 PPP Sbjct: 584 PPP 586 >AE014296-2433|AAF49702.1| 2061|Drosophila melanogaster CG9425-PA, isoform A protein. Length = 2061 Score = 31.9 bits (69), Expect = 1.5 Identities = 23/74 (31%), Positives = 24/74 (32%), Gaps = 1/74 (1%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXG-XXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXP 686 G G PP GGG G PP PP PPP P GG P Sbjct: 1332 GPGPPPHYGGGGGGGGHMGMRGPPPPAPHLRGMPPGGPPP-----TQQPGGAGGGGGPPP 1386 Query: 687 PPXPPPXXKKXXPP 728 P P + PP Sbjct: 1387 PYGQYPAMQHWRPP 1400 Score = 30.7 bits (66), Expect = 3.4 Identities = 21/76 (27%), Positives = 23/76 (30%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPP 689 G G PPPP PP P P P P G P Sbjct: 1518 GPGPPPPPSQQ------QPQAPPMGMQRGSSVPNGPMSPMENGPPPPPYLRHNGSGYNPG 1571 Query: 690 PXPPPXXKKXXPPPPP 737 PPP ++ PPP P Sbjct: 1572 APPPPPQQQPQPPPNP 1587 Score = 29.5 bits (63), Expect = 7.9 Identities = 15/49 (30%), Positives = 18/49 (36%) Frame = +3 Query: 591 IFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 ++ P PPPPP P G P P + PPPPP Sbjct: 1514 LYGPGPGPPPPPSQQQPQAPPMGMQRGSSV---PNGPMSPMENGPPPPP 1559 >AE014296-2432|AAS65008.1| 2103|Drosophila melanogaster CG9425-PB, isoform B protein. Length = 2103 Score = 31.9 bits (69), Expect = 1.5 Identities = 23/74 (31%), Positives = 24/74 (32%), Gaps = 1/74 (1%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXG-XXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXP 686 G G PP GGG G PP PP PPP P GG P Sbjct: 1374 GPGPPPHYGGGGGGGGHMGMRGPPPPAPHLRGMPPGGPPP-----TQQPGGAGGGGGPPP 1428 Query: 687 PPXPPPXXKKXXPP 728 P P + PP Sbjct: 1429 PYGQYPAMQHWRPP 1442 Score = 30.7 bits (66), Expect = 3.4 Identities = 21/76 (27%), Positives = 23/76 (30%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPP 689 G G PPPP PP P P P P G P Sbjct: 1560 GPGPPPPPSQQ------QPQAPPMGMQRGSSVPNGPMSPMENGPPPPPYLRHNGSGYNPG 1613 Query: 690 PXPPPXXKKXXPPPPP 737 PPP ++ PPP P Sbjct: 1614 APPPPPQQQPQPPPNP 1629 Score = 29.5 bits (63), Expect = 7.9 Identities = 15/49 (30%), Positives = 18/49 (36%) Frame = +3 Query: 591 IFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 ++ P PPPPP P G P P + PPPPP Sbjct: 1556 LYGPGPGPPPPPSQQQPQAPPMGMQRGSSV---PNGPMSPMENGPPPPP 1601 >AE014296-1088|AAF50683.1| 239|Drosophila melanogaster CG12330-PA protein. Length = 239 Score = 31.9 bits (69), Expect = 1.5 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXP---PPXXKKXXPPPP 734 PPP PPP P G PP P PP PPP Sbjct: 41 PPPRPPPPAPANSYGPPKKGNGKPPPAPPKPSYGPPPKNGNGKPPP 86 >AE014134-2320|AAN10833.1| 836|Drosophila melanogaster CG6043-PC, isoform C protein. Length = 836 Score = 31.9 bits (69), Expect = 1.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 594 FXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPP 728 F PPPPPPP G PPP PP PP Sbjct: 177 FQVLPPPPPPPQPQSGKNGTQ----GASAAPPPPPPQQPSTLAPP 217 >AE014134-2318|AAN10831.1| 759|Drosophila melanogaster CG6043-PB, isoform B protein. Length = 759 Score = 31.9 bits (69), Expect = 1.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 594 FXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPP 728 F PPPPPPP G PPP PP PP Sbjct: 100 FQVLPPPPPPPQPQSGKNGTQ----GASAAPPPPPPQQPSTLAPP 140 >AE014134-2317|AAF53274.2| 759|Drosophila melanogaster CG6043-PA, isoform A protein. Length = 759 Score = 31.9 bits (69), Expect = 1.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 594 FXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPP 728 F PPPPPPP G PPP PP PP Sbjct: 100 FQVLPPPPPPPQPQSGKNGTQ----GASAAPPPPPPQQPSTLAPP 140 >AE014134-2316|AAN10830.1| 918|Drosophila melanogaster CG6043-PD, isoform D protein. Length = 918 Score = 31.9 bits (69), Expect = 1.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 594 FXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPP 728 F PPPPPPP G PPP PP PP Sbjct: 100 FQVLPPPPPPPQPQSGKNGTQ----GASAAPPPPPPQQPSTLAPP 140 >AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA, isoform A protein. Length = 478 Score = 31.9 bits (69), Expect = 1.5 Identities = 21/70 (30%), Positives = 22/70 (31%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 P P GG PP P PPPPP GG PPP P Sbjct: 209 PDPMPPVGGVMVMPSPTPPPPAGGVLVMPRPPPPP----------PPAGGVLVMPPPPPS 258 Query: 702 PXXKKXXPPP 731 + PPP Sbjct: 259 FTPAEVAPPP 268 Score = 31.5 bits (68), Expect = 1.9 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP + P PPPP P PPP PP PPPPP Sbjct: 213 PPVGGVMVMPSPTPPPPAGGVLVMPRP----------PPPPPPAGGVLVMPPPPP 257 >AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB, isoform B protein. Length = 409 Score = 27.5 bits (58), Expect(2) = 1.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 228 PPPPPPPPP----PPPPPPTLS 245 Score = 23.0 bits (47), Expect(2) = 1.5 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPP 626 PP K PPPPPP Sbjct: 216 PPFYKPSRPNRRPPPPPP 233 >BT023503-1|AAY84903.1| 1327|Drosophila melanogaster LD20030p protein. Length = 1327 Score = 30.3 bits (65), Expect = 4.5 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 687 PPXPPPXXKKXXPPPPP 737 PP PPP + PPPPP Sbjct: 4 PPLPPPPVQPAPPPPPP 20 Score = 25.0 bits (52), Expect(2) = 2.3 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPP 626 PP PPPPPPP Sbjct: 4 PPLPPPPVQPAPPPPPPP 21 Score = 24.6 bits (51), Expect(2) = 2.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 684 PPPXPPPXXKKXXPP 728 PPP PPP + PP Sbjct: 15 PPPPPPPPEEDLSPP 29 >AF116572-1|AAD31170.1| 1327|Drosophila melanogaster ribonuclease protein. Length = 1327 Score = 30.3 bits (65), Expect = 4.5 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 687 PPXPPPXXKKXXPPPPP 737 PP PPP + PPPPP Sbjct: 4 PPLPPPPVQPAPPPPPP 20 Score = 25.0 bits (52), Expect(2) = 2.3 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPP 626 PP PPPPPPP Sbjct: 4 PPLPPPPVQPAPPPPPPP 21 Score = 24.6 bits (51), Expect(2) = 2.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 684 PPPXPPPXXKKXXPP 728 PPP PPP + PP Sbjct: 15 PPPPPPPPEEDLSPP 29 >AE013599-540|AAF59169.1| 1327|Drosophila melanogaster CG8730-PA protein. Length = 1327 Score = 30.3 bits (65), Expect = 4.5 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 687 PPXPPPXXKKXXPPPPP 737 PP PPP + PPPPP Sbjct: 4 PPLPPPPVQPAPPPPPP 20 Score = 25.0 bits (52), Expect(2) = 2.3 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPP 626 PP PPPPPPP Sbjct: 4 PPLPPPPVQPAPPPPPPP 21 Score = 24.6 bits (51), Expect(2) = 2.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 684 PPPXPPPXXKKXXPP 728 PPP PPP + PP Sbjct: 15 PPPPPPPPEEDLSPP 29 >BT010114-1|AAQ22583.1| 515|Drosophila melanogaster GH02426p protein. Length = 515 Score = 25.8 bits (54), Expect(2) = 2.5 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +3 Query: 684 PPPXPPPXXKKXXPP 728 PPP PPP K PP Sbjct: 398 PPPPPPPMPGKLFPP 412 Score = 23.8 bits (49), Expect(2) = 2.5 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 Query: 606 PPPPPPP 626 PPPPPPP Sbjct: 397 PPPPPPP 403 >AE014297-3395|AAX52972.1| 515|Drosophila melanogaster CG33111-PC, isoform C protein. Length = 515 Score = 25.8 bits (54), Expect(2) = 2.5 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +3 Query: 684 PPPXPPPXXKKXXPP 728 PPP PPP K PP Sbjct: 398 PPPPPPPMPGKLFPP 412 Score = 23.8 bits (49), Expect(2) = 2.5 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 Query: 606 PPPPPPP 626 PPPPPPP Sbjct: 397 PPPPPPP 403 >AE014297-3394|AAS65199.1| 515|Drosophila melanogaster CG33111-PB, isoform B protein. Length = 515 Score = 25.8 bits (54), Expect(2) = 2.5 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +3 Query: 684 PPPXPPPXXKKXXPP 728 PPP PPP K PP Sbjct: 398 PPPPPPPMPGKLFPP 412 Score = 23.8 bits (49), Expect(2) = 2.5 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 Query: 606 PPPPPPP 626 PPPPPPP Sbjct: 397 PPPPPPP 403 >AE014297-3393|AAF56193.2| 515|Drosophila melanogaster CG33111-PA, isoform A protein. Length = 515 Score = 25.8 bits (54), Expect(2) = 2.5 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +3 Query: 684 PPPXPPPXXKKXXPP 728 PPP PPP K PP Sbjct: 398 PPPPPPPMPGKLFPP 412 Score = 23.8 bits (49), Expect(2) = 2.5 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 Query: 606 PPPPPPP 626 PPPPPPP Sbjct: 397 PPPPPPP 403 >U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 31.1 bits (67), Expect = 2.6 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = -1 Query: 856 GXXGGGXGXXXKXXXXXXXGGXXXXXXPPXXFXXXXXXXXGGGGGXXFFXXGGGXGGG 683 G GGG G GG F GGGG + GGG GGG Sbjct: 214 GGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGG 271 >M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protein protein. Length = 365 Score = 31.1 bits (67), Expect = 2.6 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = -1 Query: 856 GXXGGGXGXXXKXXXXXXXGGXXXXXXPPXXFXXXXXXXXGGGGGXXFFXXGGGXGGG 683 G GGG G GG F GGGG + GGG GGG Sbjct: 176 GGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGG 233 >L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 31.1 bits (67), Expect = 2.6 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = -1 Query: 856 GXXGGGXGXXXKXXXXXXXGGXXXXXXPPXXFXXXXXXXXGGGGGXXFFXXGGGXGGG 683 G GGG G GG F GGGG + GGG GGG Sbjct: 214 GGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGG 271 >BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p protein. Length = 286 Score = 31.1 bits (67), Expect = 2.6 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGGT 603 GGGGGG F G GG G GGGGGGT Sbjct: 86 GGGGGGGF--GGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGGT 128 >BT023829-1|AAZ86750.1| 107|Drosophila melanogaster RE20030p protein. Length = 107 Score = 31.1 bits (67), Expect = 2.6 Identities = 26/80 (32%), Positives = 26/80 (32%), Gaps = 4/80 (5%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPP 689 G G PP G G G PP PP PPP G PP Sbjct: 5 GRGYGGPPPRGPGIAY--GPPPPRVNVGINIGGPPRPPPIGV-----------GIGFAPP 51 Query: 690 PX----PPPXXKKXXPPPPP 737 P PPP PPPPP Sbjct: 52 PVVVAPPPPTVIVGAPPPPP 71 >BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p protein. Length = 286 Score = 31.1 bits (67), Expect = 2.6 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGGT 603 GGGGGG F G GG G GGGGGGT Sbjct: 86 GGGGGGGF--GGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGGT 128 >AY166752-1|AAN85714.1| 1400|Drosophila melanogaster loechrig isoform I protein. Length = 1400 Score = 31.1 bits (67), Expect = 2.6 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPPPP P P PP PP P Sbjct: 279 PPPPPPPPPIPATILPKALKALLHTQEPVAPPSRPSPVGPPSP 321 >AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p protein. Length = 499 Score = 31.1 bits (67), Expect = 2.6 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPPP PPP PPP P PPP Sbjct: 335 PPPPPPPPP-----------------PPPPPPPAQTSAIPSPPP 361 >AY070541-1|AAL48012.1| 1400|Drosophila melanogaster LD22662p protein. Length = 1400 Score = 31.1 bits (67), Expect = 2.6 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPPPP P P PP PP P Sbjct: 279 PPPPPPPPPIPATILPKALKALLHTQEPVAPPSRPSPVGPPSP 321 >AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA protein. Length = 286 Score = 31.1 bits (67), Expect = 2.6 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGGT 603 GGGGGG F G GG G GGGGGGT Sbjct: 86 GGGGGGGF--GGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGGT 128 >AE014297-2948|AAF55864.2| 1400|Drosophila melanogaster CG17299-PF, isoform F protein. Length = 1400 Score = 31.1 bits (67), Expect = 2.6 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPPPP P P PP PP P Sbjct: 279 PPPPPPPPPIPATILPKALKALLHTQEPVAPPSRPSPVGPPSP 321 >AE013599-1936|AAF58220.2| 107|Drosophila melanogaster CG30479-PA protein. Length = 107 Score = 31.1 bits (67), Expect = 2.6 Identities = 26/80 (32%), Positives = 26/80 (32%), Gaps = 4/80 (5%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPP 689 G G PP G G G PP PP PPP G PP Sbjct: 5 GRGYGGPPPRGPGIAY--GPPPPRVNVGINIGGPPRPPPIGV-----------GIGFAPP 51 Query: 690 PX----PPPXXKKXXPPPPP 737 P PPP PPPPP Sbjct: 52 PVVVAPPPPTVIVGAPPPPP 71 >AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-PA protein. Length = 499 Score = 31.1 bits (67), Expect = 2.6 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPPP PPP PPP P PPP Sbjct: 335 PPPPPPPPP-----------------PPPPPPPAQTSAIPSPPP 361 >AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p protein. Length = 242 Score = 30.3 bits (65), Expect = 4.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PP PPP + PPPPP Sbjct: 113 PPAYPPPPQRPWGPPPPP 130 Score = 26.6 bits (56), Expect(2) = 2.7 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +3 Query: 690 PXPPPXXKKXXPPPPP 737 P PPP PPPPP Sbjct: 126 PPPPPGPPPPGPPPPP 141 Score = 23.0 bits (47), Expect(2) = 2.7 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPP 626 PP + + PPP PPP Sbjct: 117 PPPPQRPWGPPPPPGPPP 134 >AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA, isoform A protein. Length = 242 Score = 30.3 bits (65), Expect = 4.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PP PPP + PPPPP Sbjct: 113 PPAYPPPPQRPWGPPPPP 130 Score = 26.6 bits (56), Expect(2) = 2.7 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +3 Query: 690 PXPPPXXKKXXPPPPP 737 P PPP PPPPP Sbjct: 126 PPPPPGPPPPGPPPPP 141 Score = 23.0 bits (47), Expect(2) = 2.7 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPP 626 PP + + PPP PPP Sbjct: 117 PPPPQRPWGPPPPPGPPP 134 >BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p protein. Length = 212 Score = 30.3 bits (65), Expect = 4.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PP PPP + PPPPP Sbjct: 83 PPAYPPPPQRPWGPPPPP 100 Score = 26.6 bits (56), Expect(2) = 2.7 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +3 Query: 690 PXPPPXXKKXXPPPPP 737 P PPP PPPPP Sbjct: 96 PPPPPGPPPPGPPPPP 111 Score = 23.0 bits (47), Expect(2) = 2.7 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPP 626 PP + + PPP PPP Sbjct: 87 PPPPQRPWGPPPPPGPPP 104 >AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB, isoform B protein. Length = 212 Score = 30.3 bits (65), Expect = 4.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PP PPP + PPPPP Sbjct: 83 PPAYPPPPQRPWGPPPPP 100 Score = 26.6 bits (56), Expect(2) = 2.7 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +3 Query: 690 PXPPPXXKKXXPPPPP 737 P PPP PPPPP Sbjct: 96 PPPPPGPPPPGPPPPP 111 Score = 23.0 bits (47), Expect(2) = 2.7 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPP 626 PP + + PPP PPP Sbjct: 87 PPPPQRPWGPPPPPGPPP 104 >L14768-1|AAB39774.1| 1429|Drosophila melanogaster expanded protein. Length = 1429 Score = 30.7 bits (66), Expect = 3.4 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXP-PPXXKKXXPPPP 734 PPPPPPP P PPP P P + P PP Sbjct: 1199 PPPPPPPYVNRRLKKPPMP--APSEKPPPIPSKPIPSRMSPIPP 1240 >BT023949-1|ABB36453.1| 1312|Drosophila melanogaster IP03879p protein. Length = 1312 Score = 30.7 bits (66), Expect = 3.4 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP + P PPP Sbjct: 342 PPPPPPPPDSRSPPSPPP 359 Score = 29.5 bits (63), Expect = 7.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PP PP Sbjct: 341 PPPPPPPPPDSRSPPSPP 358 Score = 29.5 bits (63), Expect = 7.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PP PPP Sbjct: 342 PPPPPPPPDSRSPPSPPP 359 >AY069664-1|AAL39809.1| 600|Drosophila melanogaster LD44138p protein. Length = 600 Score = 30.7 bits (66), Expect = 3.4 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P PPP G P PP K PPPPP Sbjct: 378 PKPPPFIGGHLPPGYSIPSGYAGSETPPSPPMPKGPPPPPPP 419 >AY069068-1|AAL39213.1| 1427|Drosophila melanogaster GH08582p protein. Length = 1427 Score = 30.7 bits (66), Expect = 3.4 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXP-PPXXKKXXPPPP 734 PPPPPPP P PPP P P + P PP Sbjct: 1199 PPPPPPPYVNRRLKKPPMP--APSEKPPPIPSKPIPSRMSPIPP 1240 >AE014298-2943|AAN09520.1| 1034|Drosophila melanogaster CG11940-PB, isoform B protein. Length = 1034 Score = 30.7 bits (66), Expect = 3.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 685 PPPXXPXXKKKXPPPPPP 738 PPP KK PPPPPP Sbjct: 1005 PPPGNSVAAKKRPPPPPP 1022 >AE014298-2942|AAF49029.1| 1162|Drosophila melanogaster CG11940-PA, isoform A protein. Length = 1162 Score = 30.7 bits (66), Expect = 3.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 685 PPPXXPXXKKKXPPPPPP 738 PPP KK PPPPPP Sbjct: 1133 PPPGNSVAAKKRPPPPPP 1150 >AE014298-2877|AAF48974.1| 348|Drosophila melanogaster CG14218-PA protein. Length = 348 Score = 30.7 bits (66), Expect = 3.4 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPP PPP PPP P P P Sbjct: 148 PPPPPNYDYDYDYDAQPAAPAEPPPPPPPPPPPTAPPRPRPRP 190 >AE014298-2334|AAF48566.2| 1311|Drosophila melanogaster CG32577-PA protein. Length = 1311 Score = 30.7 bits (66), Expect = 3.4 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP + P PPP Sbjct: 341 PPPPPPPPDSRSPPSPPP 358 Score = 29.5 bits (63), Expect = 7.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PP PP Sbjct: 340 PPPPPPPPPDSRSPPSPP 357 Score = 29.5 bits (63), Expect = 7.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PP PPP Sbjct: 341 PPPPPPPPDSRSPPSPPP 358 >AE014297-2494|AAN13768.1| 600|Drosophila melanogaster CG7129-PB, isoform B protein. Length = 600 Score = 30.7 bits (66), Expect = 3.4 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P PPP G P PP K PPPPP Sbjct: 378 PKPPPFIGGHLPPGYSIPSGYAGSETPPSPPMPKGPPPPPPP 419 >AE014297-2493|AAF55531.1| 600|Drosophila melanogaster CG7129-PA, isoform A protein. Length = 600 Score = 30.7 bits (66), Expect = 3.4 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P PPP G P PP K PPPPP Sbjct: 378 PKPPPFIGGHLPPGYSIPSGYAGSETPPSPPMPKGPPPPPPP 419 >AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-PA protein. Length = 460 Score = 30.7 bits (66), Expect = 3.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPP 704 PPPPPP P G PPP PPP Sbjct: 51 PPPPPPSPPCGRPPPGSPPPG---PPPPGPPP 79 >AE014134-2469|AAS64704.1| 1853|Drosophila melanogaster CG32972-PA, isoform A protein. Length = 1853 Score = 30.7 bits (66), Expect = 3.4 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = +3 Query: 594 FXXXPP--PPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 F PP P PPP P P P PPP PPP P Sbjct: 1795 FPLPPPRFPLPPPPFPFIGSLPEADSAVIAILPIPPPPPIPAFPRPPPRP 1844 >AE014134-106|AAF51495.1| 1427|Drosophila melanogaster CG4114-PA protein. Length = 1427 Score = 30.7 bits (66), Expect = 3.4 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXP-PPXXKKXXPPPP 734 PPPPPPP P PPP P P + P PP Sbjct: 1199 PPPPPPPYVNRRLKKPPMP--APSEKPPPIPSKPIPSRMSPIPP 1240 >BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p protein. Length = 468 Score = 30.3 bits (65), Expect = 4.5 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P P P P G PPP PPP PPP P Sbjct: 170 PKAAPAPAAAPKPAPPPPAAGAPK--PPPPPPPKAAPRPPPPAP 211 >AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p protein. Length = 295 Score = 30.3 bits (65), Expect = 4.5 Identities = 21/76 (27%), Positives = 23/76 (30%), Gaps = 4/76 (5%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPP----PXXXXXXXXPXXXXGGXXXXPP 689 PPPP + PP K + PPP P P P PP Sbjct: 156 PPPPPVVAPKPTYLPPSPPESKYL----PPPTPEVKYLPPAPVARYLPPKVAPSLPPPPP 211 Query: 690 PXPPPXXKKXXPPPPP 737 P P K PP P Sbjct: 212 PPPVAPKKLYLPPAEP 227 Score = 29.5 bits (63), Expect = 7.9 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXP---PPXXKKXXPPPPP 737 PPPPPPP P P P PP PPPPP Sbjct: 114 PPPPPPP--PKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPP 158 Score = 29.5 bits (63), Expect = 7.9 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPP P PP PPPPP Sbjct: 116 PPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPP 159 >AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p protein. Length = 468 Score = 30.3 bits (65), Expect = 4.5 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P P P P G PPP PPP PPP P Sbjct: 170 PKAAPAPAAAPKPAPPPPAAGAPK--PPPPPPPKAAPRPPPPAP 211 >AE014298-1529|AAF47983.2| 2602|Drosophila melanogaster CG2174-PA, isoform A protein. Length = 2602 Score = 30.3 bits (65), Expect = 4.5 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPP PP P PPP PP PPP P Sbjct: 1417 PPPAPPSGGWPGVLLPPAP--SVPAPPPPIRPPSMAPPAPPPAP 1458 >AE014298-1528|ABI30975.1| 2693|Drosophila melanogaster CG2174-PB, isoform B protein. Length = 2693 Score = 30.3 bits (65), Expect = 4.5 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPP PP P PPP PP PPP P Sbjct: 1508 PPPAPPSGGWPGVLLPPAP--SVPAPPPPIRPPSMAPPAPPPAP 1549 >AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA protein. Length = 468 Score = 30.3 bits (65), Expect = 4.5 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P P P P G PPP PPP PPP P Sbjct: 170 PKAAPAPAAAPKPAPPPPAAGAPK--PPPPPPPKAAPRPPPPAP 211 >AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA protein. Length = 295 Score = 30.3 bits (65), Expect = 4.5 Identities = 21/76 (27%), Positives = 23/76 (30%), Gaps = 4/76 (5%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPP----PXXXXXXXXPXXXXGGXXXXPP 689 PPPP + PP K + PPP P P P PP Sbjct: 156 PPPPPVVAPKPTYLPPSPPESKYL----PPPTPEVKYLPPAPVARYLPPKVAPSLPPPPP 211 Query: 690 PXPPPXXKKXXPPPPP 737 P P K PP P Sbjct: 212 PPPVAPKKLYLPPAEP 227 Score = 29.5 bits (63), Expect = 7.9 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXP---PPXXKKXXPPPPP 737 PPPPPPP P P P PP PPPPP Sbjct: 114 PPPPPPP--PKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPP 158 Score = 29.5 bits (63), Expect = 7.9 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPP P PP PPPPP Sbjct: 116 PPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPP 159 >X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. Length = 239 Score = 29.9 bits (64), Expect = 6.0 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 736 GGGGGXXFFXXGGGXGGG 683 GGGGG F GGG GGG Sbjct: 19 GGGGGRGFGGGGGGRGGG 36 >BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p protein. Length = 399 Score = 29.9 bits (64), Expect = 6.0 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 736 GGGGGXXFFXXGGGXGGG 683 GGGGG F GGG GGG Sbjct: 238 GGGGGGGRFDRGGGGGGG 255 >AY113488-1|AAM29493.1| 435|Drosophila melanogaster RE47056p protein. Length = 435 Score = 29.9 bits (64), Expect = 6.0 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPP 626 GGG P GGG PP IF P PPPP Sbjct: 294 GGGAP----GGGGYVNVRRTPPPPLSSIFPRPPTVPPPP 328 >AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p protein. Length = 299 Score = 29.9 bits (64), Expect = 6.0 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 736 GGGGGXXFFXXGGGXGGG 683 GGGGG F GGG GGG Sbjct: 21 GGGGGRGFGGGGGGRGGG 38 >AF053091-1|AAC06254.1| 2715|Drosophila melanogaster eyelid protein. Length = 2715 Score = 29.9 bits (64), Expect = 6.0 Identities = 20/72 (27%), Positives = 22/72 (30%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP G + PP + P P P G P P P Sbjct: 612 PPPPPQGAAGGGYP--MPPHMHGGYKMGGPGQSPGAQGYPPQQPQQYPPGNYP-PRPQYP 668 Query: 702 PXXKKXXPPPPP 737 P PPPPP Sbjct: 669 PGAYATGPPPPP 680 >AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB, isoform B protein. Length = 399 Score = 29.9 bits (64), Expect = 6.0 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 736 GGGGGXXFFXXGGGXGGG 683 GGGGG F GGG GGG Sbjct: 238 GGGGGGGRFDRGGGGGGG 255 >AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA, isoform A protein. Length = 399 Score = 29.9 bits (64), Expect = 6.0 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 736 GGGGGXXFFXXGGGXGGG 683 GGGGG F GGG GGG Sbjct: 238 GGGGGGGRFDRGGGGGGG 255 >AE014298-979|AAF46221.2| 1027|Drosophila melanogaster CG14431-PA protein. Length = 1027 Score = 29.9 bits (64), Expect = 6.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPP 734 PPP PPP PPPP Sbjct: 477 PPPPPPPPSPSYEPPPP 493 >AE014297-2398|AAN13750.1| 2716|Drosophila melanogaster CG7467-PB, isoform B protein. Length = 2716 Score = 29.9 bits (64), Expect = 6.0 Identities = 20/72 (27%), Positives = 22/72 (30%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP G + PP + P P P G P P P Sbjct: 613 PPPPPQGAAGGGYP--MPPHMHGGYKMGGPGQSPGAQGYPPQQPQQYPPGNYP-PRPQYP 669 Query: 702 PXXKKXXPPPPP 737 P PPPPP Sbjct: 670 PGAYATGPPPPP 681 >AE014297-2397|AAS65166.1| 2556|Drosophila melanogaster CG7467-PC, isoform C protein. Length = 2556 Score = 29.9 bits (64), Expect = 6.0 Identities = 20/72 (27%), Positives = 22/72 (30%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP G + PP + P P P G P P P Sbjct: 613 PPPPPQGAAGGGYP--MPPHMHGGYKMGGPGQSPGAQGYPPQQPQQYPPGNYP-PRPQYP 669 Query: 702 PXXKKXXPPPPP 737 P PPPPP Sbjct: 670 PGAYATGPPPPP 681 >AE014297-2396|AAF55457.1| 2703|Drosophila melanogaster CG7467-PA, isoform A protein. Length = 2703 Score = 29.9 bits (64), Expect = 6.0 Identities = 20/72 (27%), Positives = 22/72 (30%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP G + PP + P P P G P P P Sbjct: 613 PPPPPQGAAGGGYP--MPPHMHGGYKMGGPGQSPGAQGYPPQQPQQYPPGNYP-PRPQYP 669 Query: 702 PXXKKXXPPPPP 737 P PPPPP Sbjct: 670 PGAYATGPPPPP 681 >AE014134-1066|AAF52356.2| 808|Drosophila melanogaster CG31640-PA protein. Length = 808 Score = 29.9 bits (64), Expect = 6.0 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPP 626 GGG P GGG PP IF P PPPP Sbjct: 524 GGGAP----GGGGYVNVRRTPPPPLSSIFPRPPTVPPPP 558 >AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-PA protein. Length = 239 Score = 29.9 bits (64), Expect = 6.0 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 582 KKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPP 704 KK PPPPPPP P PPP PPP Sbjct: 178 KKPNHGQYPPPPPPP-----PYYPPYPYYPPPPPPPPLPPP 213 >AY119067-1|AAM50927.1| 217|Drosophila melanogaster LP08165p protein. Length = 217 Score = 29.5 bits (63), Expect = 7.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPP 734 PPP PPP PPPP Sbjct: 98 PPPPPPPPPAPAPPPPP 114 Score = 29.5 bits (63), Expect = 7.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 687 PPXPPPXXKKXXPPPPP 737 PP PPP PPPPP Sbjct: 98 PPPPPPPPPAPAPPPPP 114 >AM412918-1|CAL85541.1| 178|Drosophila melanogaster CG16743 protein protein. Length = 178 Score = 29.5 bits (63), Expect = 7.9 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPPP P G P PP + P P Sbjct: 94 PPPPPPPPHPQQAPPPSMYPPGPSGYPGGYPPQGAPEQNPVNNP 137 >AE014297-2379|AAF55444.1| 137|Drosophila melanogaster CG14326-PA protein. Length = 137 Score = 29.5 bits (63), Expect = 7.9 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGG---GGGG 606 GGGGGG F G GG P P GG GGGG Sbjct: 61 GGGGGGLFGNLLGGLLGGNRPQPQPYPVPVPAYGGGFGGGYPIGGGG 107 >AE014134-2984|AAF53715.3| 1377|Drosophila melanogaster CG10600-PA protein. Length = 1377 Score = 29.5 bits (63), Expect = 7.9 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 P PP P + PPPPPP Sbjct: 1260 PLPPLPPSRTSAPPPPPP 1277 >AE014297-832|AAF54301.3| 2090|Drosophila melanogaster CG31349-PA, isoform A protein. Length = 2090 Score = 26.6 bits (56), Expect(2) = 8.2 Identities = 12/37 (32%), Positives = 12/37 (32%) Frame = +3 Query: 516 GXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPP 626 G PPP G G P P PPP P Sbjct: 1091 GVVPPPNVSNGQGQMNGSGTPSSNGSGPFKPVPPPKP 1127 Score = 21.0 bits (42), Expect(2) = 8.2 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +3 Query: 690 PXPPPXXKKXXPP 728 P PPP K PP Sbjct: 1121 PVPPPKPKNYRPP 1133 >AE014297-834|AAF54300.3| 1371|Drosophila melanogaster CG31349-PB, isoform B protein. Length = 1371 Score = 26.6 bits (56), Expect(2) = 8.5 Identities = 12/37 (32%), Positives = 12/37 (32%) Frame = +3 Query: 516 GXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPP 626 G PPP G G P P PPP P Sbjct: 1169 GVVPPPNVSNGQGQMNGSGTPSSNGSGPFKPVPPPKP 1205 Score = 21.0 bits (42), Expect(2) = 8.5 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +3 Query: 690 PXPPPXXKKXXPP 728 P PPP K PP Sbjct: 1199 PVPPPKPKNYRPP 1211 >D83477-1|BAA11923.1| 1367|Drosophila melanogaster TamA protein. Length = 1367 Score = 26.6 bits (56), Expect(2) = 8.5 Identities = 12/37 (32%), Positives = 12/37 (32%) Frame = +3 Query: 516 GXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPP 626 G PPP G G P P PPP P Sbjct: 1165 GVVPPPNVSNGQGQMNGSGTPSSNGSGPFKPVPPPKP 1201 Score = 21.0 bits (42), Expect(2) = 8.5 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +3 Query: 690 PXPPPXXKKXXPP 728 P PPP K PP Sbjct: 1195 PVPPPKPKNYRPP 1207 >AE014297-833|AAN13403.2| 1293|Drosophila melanogaster CG31349-PC, isoform C protein. Length = 1293 Score = 26.6 bits (56), Expect(2) = 8.5 Identities = 12/37 (32%), Positives = 12/37 (32%) Frame = +3 Query: 516 GXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPP 626 G PPP G G P P PPP P Sbjct: 1091 GVVPPPNVSNGQGQMNGSGTPSSNGSGPFKPVPPPKP 1127 Score = 21.0 bits (42), Expect(2) = 8.5 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +3 Query: 690 PXPPPXXKKXXPP 728 P PPP K PP Sbjct: 1121 PVPPPKPKNYRPP 1133 >AY061056-1|AAL28604.1| 487|Drosophila melanogaster LD02541p protein. Length = 487 Score = 26.6 bits (56), Expect(2) = 9.2 Identities = 12/37 (32%), Positives = 12/37 (32%) Frame = +3 Query: 516 GXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPP 626 G PPP G G P P PPP P Sbjct: 285 GVVPPPNVSNGQGQMNGSGTPSSNGSGPFKPVPPPKP 321 Score = 21.0 bits (42), Expect(2) = 9.2 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +3 Query: 690 PXPPPXXKKXXPP 728 P PPP K PP Sbjct: 315 PVPPPKPKNYRPP 327 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,131,708 Number of Sequences: 53049 Number of extensions: 961612 Number of successful extensions: 26515 Number of sequences better than 10.0: 179 Number of HSP's better than 10.0 without gapping: 2838 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13251 length of database: 24,988,368 effective HSP length: 86 effective length of database: 20,426,154 effective search space used: 5249521578 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -