BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_B14 (1033 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61080.1 68414.m06877 proline-rich family protein 54 2e-07 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 49 4e-06 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 48 1e-05 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 46 5e-05 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 44 1e-04 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 44 1e-04 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 44 2e-04 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 44 2e-04 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 43 4e-04 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 41 0.001 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 41 0.002 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 39 0.006 At4g18570.1 68417.m02749 proline-rich family protein common fami... 38 0.008 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 38 0.011 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 38 0.011 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 38 0.014 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 38 0.014 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 38 0.014 At1g53260.1 68414.m06035 hypothetical protein low similarity to ... 38 0.014 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 37 0.019 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 37 0.019 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 37 0.019 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 37 0.025 At2g43800.1 68415.m05445 formin homology 2 domain-containing pro... 37 0.025 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 37 0.025 At5g02600.2 68418.m00195 heavy-metal-associated domain-containin... 30 0.031 At5g02600.1 68418.m00196 heavy-metal-associated domain-containin... 30 0.031 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 36 0.033 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 36 0.033 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 36 0.033 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 36 0.044 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 36 0.044 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 36 0.058 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 36 0.058 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 35 0.076 At1g70990.1 68414.m08190 proline-rich family protein 35 0.076 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 27 0.090 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 35 0.10 At3g51290.1 68416.m05614 proline-rich family protein 35 0.10 At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family... 35 0.10 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 27 0.12 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 34 0.13 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 34 0.13 At3g50180.1 68416.m05486 hypothetical protein 34 0.13 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 34 0.13 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 34 0.13 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 34 0.18 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 34 0.18 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 34 0.18 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 30 0.20 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 33 0.23 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 33 0.23 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 33 0.23 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 33 0.31 At5g35190.1 68418.m04170 proline-rich extensin-like family prote... 33 0.31 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 33 0.31 At3g32400.1 68416.m04142 formin homology 2 domain-containing pro... 33 0.31 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 33 0.31 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 27 0.33 At5g60850.1 68418.m07633 Dof-type zinc finger domain-containing ... 33 0.41 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 33 0.41 At3g24550.1 68416.m03083 protein kinase family protein contains ... 33 0.41 At3g11402.1 68416.m01388 DC1 domain-containing protein contains ... 33 0.41 At1g15830.1 68414.m01900 expressed protein 33 0.41 At2g39250.1 68415.m04820 AP2 domain-containing transcription fac... 26 0.45 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 32 0.54 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 32 0.54 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 32 0.54 At3g18810.1 68416.m02389 protein kinase family protein contains ... 32 0.54 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 32 0.54 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 32 0.54 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 32 0.54 At1g21310.1 68414.m02662 proline-rich extensin-like family prote... 32 0.54 At1g12810.1 68414.m01488 proline-rich family protein contains pr... 32 0.54 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 32 0.71 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 27 0.74 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 31 0.94 At3g54580.1 68416.m06039 proline-rich extensin-like family prote... 31 0.94 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 31 0.94 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 31 1.2 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 31 1.2 At3g24540.1 68416.m03082 protein kinase family protein contains ... 31 1.2 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 31 1.2 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 31 1.2 At3g55950.1 68416.m06217 protein kinase family protein contains ... 25 1.5 At3g04610.1 68416.m00493 KH domain-containing protein similar pu... 31 1.6 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 30 2.2 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 30 2.2 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 30 2.2 At4g08410.1 68417.m01390 proline-rich extensin-like family prote... 30 2.2 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 30 2.2 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 30 2.2 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 30 2.2 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 30 2.2 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 30 2.2 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 30 2.2 At4g03390.1 68417.m00461 leucine-rich repeat transmembrane prote... 27 2.5 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 29 2.6 At2g23770.1 68415.m02839 protein kinase family protein / peptido... 25 2.6 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 25 2.7 At4g23890.1 68417.m03436 expressed protein hypothetical protein,... 26 2.8 At5g38560.1 68418.m04662 protein kinase family protein contains ... 30 2.9 At4g33660.1 68417.m04781 expressed protein 30 2.9 At4g21720.1 68417.m03145 expressed protein 30 2.9 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 30 2.9 At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family... 30 2.9 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 30 2.9 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 29 3.8 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 29 3.8 At5g06640.1 68418.m00750 proline-rich extensin-like family prote... 29 3.8 At5g06630.1 68418.m00749 proline-rich extensin-like family prote... 29 3.8 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 29 3.8 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 29 3.8 At2g34670.1 68415.m04259 proline-rich family protein contains pr... 29 3.8 At2g24980.1 68415.m02987 proline-rich extensin-like family prote... 29 3.8 At1g75550.1 68414.m08780 glycine-rich protein 29 3.8 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 29 3.8 At1g07310.1 68414.m00778 C2 domain-containing protein contains s... 29 3.8 At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 29 5.0 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 29 5.0 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 29 5.0 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 29 5.0 At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) fa... 29 5.0 At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) fa... 29 5.0 At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family... 29 5.0 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 29 6.6 At5g53060.1 68418.m06592 KH domain-containing protein 29 6.6 At5g25550.1 68418.m03040 leucine-rich repeat family protein / ex... 29 6.6 At5g10060.1 68418.m01165 expressed protein 29 6.6 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 29 6.6 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 29 6.6 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 29 6.6 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 29 6.6 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 29 6.6 At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family... 29 6.6 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 29 6.6 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 29 6.6 At1g02710.1 68414.m00222 glycine-rich protein 29 6.6 At1g29230.1 68414.m03575 CBL-interacting protein kinase 18 (CIPK... 25 7.4 At3g51710.1 68416.m05670 curculin-like (mannose-binding) lectin ... 26 7.5 At5g46730.1 68418.m05757 glycine-rich protein 28 8.8 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 28 8.8 At4g03120.1 68417.m00425 proline-rich family protein similar to ... 28 8.8 At3g28630.2 68416.m03574 expressed protein contains Pfam profil... 28 8.8 At3g28630.1 68416.m03573 expressed protein contains Pfam profil... 28 8.8 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 28 8.8 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 28 8.8 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 28 8.8 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 28 8.8 At1g26150.1 68414.m03192 protein kinase family protein similar t... 28 8.8 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 53.6 bits (123), Expect = 2e-07 Identities = 29/98 (29%), Positives = 31/98 (31%), Gaps = 3/98 (3%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP---XX 743 PP PPPPPPP P G PPP PPP + PPPPP Sbjct: 513 PPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQN 572 Query: 744 XSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 + G PP PPP P Sbjct: 573 RAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPP 610 Score = 48.8 bits (111), Expect = 6e-06 Identities = 32/111 (28%), Positives = 33/111 (29%), Gaps = 2/111 (1%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP G PP PPPPPP P PPP PP Sbjct: 536 PPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPP 595 Query: 702 --PXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPP 848 P PPPPP + G PP P PPP Sbjct: 596 PMPLANGATPPPPPPPMA-----MANGAAGPPPPPPRMGMANGAAGPPPPP 641 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 3/58 (5%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXG---GXXXXPPPXPPPXXKKXXPPPPP 737 PP K + PPPPPPP P PPP PPP PPPPP Sbjct: 497 PPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPP 554 Score = 37.5 bits (83), Expect = 0.014 Identities = 31/112 (27%), Positives = 32/112 (28%), Gaps = 3/112 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXI--FXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX 695 PPPP PP I PPPPPP P PPP Sbjct: 423 PPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFA--PPPPPPL 480 Query: 696 PPPXXK-KXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPP 848 PP K PPPP + G PP P PPP Sbjct: 481 PPAVMPLKHFAPPPPTPPAF--KPLKGSAPPPPPPPPLPTTIAAPPPPPPPP 530 Score = 35.9 bits (79), Expect = 0.044 Identities = 24/90 (26%), Positives = 25/90 (27%), Gaps = 1/90 (1%) Frame = +3 Query: 591 IFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP-PXXKKXXPPPPPXXXSXXKXXX 767 +F PPPPPPP PPP PP PPPPP Sbjct: 414 LFPPPPPPPPPPPLSFIKTASLPLPS-----PPPTPPIADIAISMPPPPPPPPPPPAVMP 468 Query: 768 XGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PP PPP P Sbjct: 469 LKHFAPPPPPPLPPAVMPLKHFAPPPPTPP 498 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/72 (31%), Positives = 25/72 (34%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP ++ PPPPPPP P P P P Sbjct: 471 PPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPT 530 Query: 702 PXXKKXXPPPPP 737 P PPPPP Sbjct: 531 PVYCTRPPPPPP 542 Score = 48.0 bits (109), Expect = 1e-05 Identities = 25/76 (32%), Positives = 25/76 (32%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP PPPPPPP P PPP PP Sbjct: 444 PPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPP 503 Query: 702 PXXKKXXPPPPPXXXS 749 P PPPP S Sbjct: 504 PPPPPVYSPPPPPVYS 519 Score = 46.4 bits (105), Expect = 3e-05 Identities = 33/114 (28%), Positives = 36/114 (31%), Gaps = 2/114 (1%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKX--IFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX 695 PPPP PP ++ PPPPPPP P PPP Sbjct: 410 PPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 469 Query: 696 PPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PPP PPPPP S PP + P PPP P Sbjct: 470 PPP------PPPPPPVYS---------PPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/72 (29%), Positives = 22/72 (30%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP P PPPPP P PP PP Sbjct: 563 PPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPP 622 Query: 702 PXXKKXXPPPPP 737 P + PPPPP Sbjct: 623 PCIEYSPPPPPP 634 Score = 38.7 bits (86), Expect = 0.006 Identities = 25/81 (30%), Positives = 25/81 (30%), Gaps = 5/81 (6%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPP---- 689 PPPP PP PPPPPP P PP Sbjct: 592 PPPPTPVSSPPPTPVYSPPPPPPCIE--PPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYS 649 Query: 690 -PXPPPXXKKXXPPPPPXXXS 749 P PPP PPPPP S Sbjct: 650 SPPPPPVYYSSPPPPPPVHYS 670 Score = 36.7 bits (81), Expect = 0.025 Identities = 25/81 (30%), Positives = 26/81 (32%), Gaps = 5/81 (6%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXP-----PPPPPPXXXXXXXXPXXXXGGXXXXP 686 PPPP PP + P PPPPPP P Sbjct: 575 PPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYS------ 628 Query: 687 PPXPPPXXKKXXPPPPPXXXS 749 PP PPP PPPPP S Sbjct: 629 PPPPPPVVHYSSPPPPPVYYS 649 Score = 35.1 bits (77), Expect = 0.076 Identities = 21/74 (28%), Positives = 22/74 (29%), Gaps = 2/74 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXP--PPPPPPXXXXXXXXPXXXXGGXXXXPPPX 695 PPPP + PP PPPP P P PP Sbjct: 521 PPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHS 580 Query: 696 PPPXXKKXXPPPPP 737 PPP PPPP Sbjct: 581 PPPPIYPYLSPPPP 594 Score = 34.7 bits (76), Expect = 0.10 Identities = 24/76 (31%), Positives = 25/76 (32%), Gaps = 4/76 (5%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP--PPPXXXXXXXXPXXXXGGXXXXPPPX 695 PPPP + PP PPPP PPP P P P Sbjct: 552 PPPPEP-----YYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPV 606 Query: 696 --PPPXXKKXXPPPPP 737 PPP PPPPP Sbjct: 607 YSPPPPPPCIEPPPPP 622 Score = 33.9 bits (74), Expect = 0.18 Identities = 22/83 (26%), Positives = 23/83 (27%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXX 788 P PPP P PPP PP PPPPP Sbjct: 401 PLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVY------SPPPP 454 Query: 789 XXPPXXXXXFXFXXXPXPPPXXP 857 PP + P PPP P Sbjct: 455 PPPPPPPPVYSPPPPPPPPPPPP 477 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 5/48 (10%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXP-----PPXPPPXXKKXXPPPPP 737 PPPPPP P P PP PP + PPP P Sbjct: 661 PPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAP 708 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP P + PPPPPP Sbjct: 618 PPPPPPCIEYSPPPPPP 634 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 4/50 (8%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPP----PXPPPXXKKXXPPPPPXXXS 749 PPPPP P PP PPP PPP P S Sbjct: 641 PPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYS 690 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/60 (30%), Positives = 20/60 (33%), Gaps = 5/60 (8%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX-----PPPXXKKXXPPPPP 737 PP + PPPP P P PPP PPP + PPP P Sbjct: 682 PPPSPVHYSSPPPPPSAPCEESPPPAPVVHHS----PPPPMVHHSPPPPVIHQSPPPPSP 737 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 48.0 bits (109), Expect = 1e-05 Identities = 29/98 (29%), Positives = 30/98 (30%), Gaps = 3/98 (3%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP---PXXKKXXPPPPPXX 743 PP + I PPPPPP PPP PP P K PPPPP Sbjct: 606 PPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPP 665 Query: 744 XSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 S G PP P PP P Sbjct: 666 TSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPP 703 Score = 43.2 bits (97), Expect = 3e-04 Identities = 26/92 (28%), Positives = 27/92 (29%), Gaps = 8/92 (8%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKK--------XXPPPPPXXXSXXKX 761 PPPPPPP P PPP PPP + PPPPP Sbjct: 574 PPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGN 633 Query: 762 XXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PP P PPP P Sbjct: 634 KRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPP 665 Score = 41.5 bits (93), Expect = 9e-04 Identities = 32/120 (26%), Positives = 36/120 (30%), Gaps = 8/120 (6%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP + PPPPPPP P PPP PP Sbjct: 572 PPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSP------SAPPPPPPPP 625 Query: 702 P------XXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXP--XPPPXXP 857 P ++ PPPPP + PP P PPP P Sbjct: 626 PSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPP 685 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXX---PXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP K I PP PPP P P P PPP K PPPPP Sbjct: 686 PPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPP 743 Score = 37.9 bits (84), Expect = 0.011 Identities = 32/116 (27%), Positives = 33/116 (28%), Gaps = 8/116 (6%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXX-----PXXXXGGXXXXP 686 PPPP PP PPPPPPP P Sbjct: 659 PPPPPPPTSHSGSIRVGPPSTPP-----PPPPPPPKANISNAPKPPAPPPLPPSSTRLGA 713 Query: 687 PPXPPP--XXKKXXPPPPPXXXSXXKXXXXG-GXXXXXXPPXXXXXFXFXXXPXPP 845 PP PPP K PPPPP + G G PP P PP Sbjct: 714 PPPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLGAKGSNAPPPPPP 769 Score = 35.9 bits (79), Expect = 0.044 Identities = 28/96 (29%), Positives = 28/96 (29%), Gaps = 1/96 (1%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSX 752 PP PPPPPPP P P PPP PPPPP S Sbjct: 471 PPSSGDHVTLLPPPPPPP--------PPPLFTSTTSFSPSQPPP-----PPPPPPLFMST 517 Query: 753 XKXXXXGGXXXXXXPPXXXXXFXF-XXXPXPPPXXP 857 PP F P PPP P Sbjct: 518 TSFSPSQPPPPPPPPPLFTSTTSFSPSQPPPPPPLP 553 Score = 35.1 bits (77), Expect = 0.076 Identities = 24/88 (27%), Positives = 24/88 (27%) Frame = +3 Query: 594 FXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXG 773 F PPPPPP P PP PPP PPPP S Sbjct: 541 FSPSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPP------PPPPLPSRSIPPPLAQP 594 Query: 774 GXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PP P PP P Sbjct: 595 PPPRPPPPPPPPPSSRSIPSPSAPPPPP 622 Score = 31.9 bits (69), Expect = 0.71 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P K PPPPP Sbjct: 715 PPPPPPPLSKTPAPPPPP 732 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P P PPPP Sbjct: 714 PPPPPPPPLSKTPAPPPP 731 Score = 28.3 bits (60), Expect = 8.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 P PP P K PPPPP Sbjct: 726 PAPPPPPLSKTPVPPPPP 743 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP PPPPPP P G PPP PPP K PPPPP Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKG-PAAPPPPPPPGKKGAGPPPPP 425 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PP PPPPPPP P G PPP PPP KK P PP Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPP-PPPMSKKGPPKPP 436 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXS 749 PPPPPPP P G PP PPP KK PPPP S Sbjct: 384 PPPPPPPSAAAPPPPPPPKKG---PAAPPPPPPPGKKGAGPPPPPPMS 428 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 615 PPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P P P G PP PPP PPPPP Sbjct: 360 PLTPGQFTTANAPPAPPGPANQTSPPPPPPPSAAAPPPPPP 400 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 652 PXXXGGGGXXXPPPXXPXXKKKXPPPPPP 738 P G PPP P PPPPPP Sbjct: 373 PAPPGPANQTSPPPPPPPSAAAPPPPPPP 401 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = +3 Query: 564 GXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 G PP PPPPPPP P PPP PP PPPPP Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP 430 Score = 41.9 bits (94), Expect = 7e-04 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPPP P PPP P P PPPPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Score = 41.5 bits (93), Expect = 9e-04 Identities = 25/81 (30%), Positives = 27/81 (33%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXX 785 PPPPPPP P PPP PPP P PPP S Sbjct: 379 PPPPPPPPPPPPPPPPPPP-------PPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Query: 786 XXXPPXXXXXFXFXXXPXPPP 848 PP + + P PPP Sbjct: 432 YVYPPPPSPPYVY---PPPPP 449 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +3 Query: 594 FXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 F PP PPPP P PPP PPP PPPPP Sbjct: 372 FGCSPPSPPPPPPPPPPPPPPPPP-PPPPPPPPPPPPYVYPSPPPPPP 418 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/72 (31%), Positives = 25/72 (34%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP ++ PPPPP P P PPP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP-----PYVYPPPPSP 440 Query: 702 PXXKKXXPPPPP 737 P PPPPP Sbjct: 441 PY---VYPPPPP 449 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 668 GXXXXXPPPPXPXXKKXXPPPPPP 739 G PPPP P PPPPPP Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPP 396 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/58 (31%), Positives = 20/58 (34%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PPP PPP PPPPP PP + + P PPP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPP---------------PPPPPPPYVYPSPPPPPPSPP 421 Score = 32.3 bits (70), Expect = 0.54 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 380 PPPPPPPPPPPPPPPPPP 397 Score = 32.3 bits (70), Expect = 0.54 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 381 PPPPPPPPPPPPPPPPPP 398 Score = 32.3 bits (70), Expect = 0.54 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 382 PPPPPPPPPPPPPPPPPP 399 Score = 32.3 bits (70), Expect = 0.54 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 383 PPPPPPPPPPPPPPPPPP 400 Score = 32.3 bits (70), Expect = 0.54 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 384 PPPPPPPPPPPPPPPPPP 401 Score = 32.3 bits (70), Expect = 0.54 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 385 PPPPPPPPPPPPPPPPPP 402 Score = 32.3 bits (70), Expect = 0.54 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 386 PPPPPPPPPPPPPPPPPP 403 Score = 32.3 bits (70), Expect = 0.54 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 387 PPPPPPPPPPPPPPPPPP 404 Score = 32.3 bits (70), Expect = 0.54 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 388 PPPPPPPPPPPPPPPPPP 405 Score = 32.3 bits (70), Expect = 0.54 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 389 PPPPPPPPPPPPPPPPPP 406 Score = 32.3 bits (70), Expect = 0.54 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 390 PPPPPPPPPPPPPPPPPP 407 Score = 31.5 bits (68), Expect = 0.94 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 401 PPPPPPPYVYPSPPPPPP 418 Score = 29.5 bits (63), Expect = 3.8 Identities = 20/70 (28%), Positives = 21/70 (30%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP PPPPPP P PPP P Sbjct: 398 PPPPPPPPPPYVYPSPPPPPPSPP-PYVYPPPPPPYVYPPPPSP------PYVYPPPPPS 450 Query: 702 PXXKKXXPPP 731 P PP Sbjct: 451 PQPYMYPSPP 460 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/118 (25%), Positives = 34/118 (28%), Gaps = 6/118 (5%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXI---FXXXPPPPP---PPXXXXXXXXPXXXXGGXXXX 683 PPPP F PP + F PPPP P P Sbjct: 440 PPPPPSSKMSPTFRATPPPPSSKMSPSFRATPPPPSSKMSPSFRATPPPPSSKMSPSVKA 499 Query: 684 PPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PP PPP + PPPP S PP + + P P P P Sbjct: 500 YPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPP 557 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P P PP P PPP PP PPPPP Sbjct: 594 PSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPP 636 Score = 32.3 bits (70), Expect = 0.54 Identities = 20/70 (28%), Positives = 21/70 (30%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP + PPPPP P P P PP Sbjct: 501 PPPPPP---PEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPP 557 Query: 702 PXXKKXXPPP 731 P PPP Sbjct: 558 PPYIYSSPPP 567 Score = 31.5 bits (68), Expect = 0.94 Identities = 22/75 (29%), Positives = 22/75 (29%), Gaps = 3/75 (4%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPP---PXXXXXXXXPXXXXGGXXXXPPP 692 PPPP PP PPPPPP P P PPP Sbjct: 607 PPPPTYYATQSP---PPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPP 663 Query: 693 XPPPXXKKXXPPPPP 737 P PPPP Sbjct: 664 PPVYYSPVTQSPPPP 678 Score = 31.5 bits (68), Expect = 0.94 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 7/66 (10%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPP----PXPPPXXKK---XXPPP 731 PP PPPPPPP P PP P PPP PPP Sbjct: 607 PPPPTYYATQSPPPPPPPTYYAVQSPPPPP---PVYYPPVTASPPPPPVYYTPVIQSPPP 663 Query: 732 PPXXXS 749 PP S Sbjct: 664 PPVYYS 669 Score = 30.7 bits (66), Expect = 1.6 Identities = 21/75 (28%), Positives = 21/75 (28%), Gaps = 3/75 (4%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPP---PPXXXXXXXXPXXXXGGXXXXPPP 692 PPPP PP PPP P PP P PPP Sbjct: 662 PPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPP 721 Query: 693 XPPPXXKKXXPPPPP 737 P PPPP Sbjct: 722 SPVYYPPVAKSPPPP 736 Score = 29.9 bits (64), Expect = 2.9 Identities = 21/75 (28%), Positives = 21/75 (28%), Gaps = 3/75 (4%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPP---PPXXXXXXXXPXXXXGGXXXXPPP 692 PPPP PP PPPPP P P PPP Sbjct: 633 PPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPP 692 Query: 693 XPPPXXKKXXPPPPP 737 P PPPP Sbjct: 693 SPVYYPPVTQSPPPP 707 Score = 29.5 bits (63), Expect = 3.8 Identities = 21/75 (28%), Positives = 21/75 (28%), Gaps = 3/75 (4%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPP---PXXXXXXXXPXXXXGGXXXXPPP 692 PPPP PP PPPPPP P PPP Sbjct: 647 PPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPP 706 Query: 693 XPPPXXKKXXPPPPP 737 P PPPP Sbjct: 707 PPVYYLPVTQSPPPP 721 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP + PPPPPP Sbjct: 607 PPPPTYYATQSPPPPPPP 624 Score = 29.1 bits (62), Expect = 5.0 Identities = 20/74 (27%), Positives = 20/74 (27%), Gaps = 2/74 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPP--PXXXXXXXXPXXXXGGXXXXPPPX 695 PPPP PP PPPPP P PPP Sbjct: 619 PPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPP 678 Query: 696 PPPXXKKXXPPPPP 737 PP PPP Sbjct: 679 PPVYYPPVTQSPPP 692 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPP Sbjct: 619 PPPPPPTYYAVQSPPPPP 636 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP PPPPPP Sbjct: 620 PPPPPTYYAVQSPPPPPP 637 Score = 28.3 bits (60), Expect = 8.8 Identities = 22/97 (22%), Positives = 26/97 (26%), Gaps = 6/97 (6%) Frame = +3 Query: 576 PXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP-----PXXKKXXP-PPPP 737 P I+ PPP P P P P PP P ++ P P PP Sbjct: 540 PPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPP 599 Query: 738 XXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPP 848 PP + P PPP Sbjct: 600 YYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPP 636 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/76 (31%), Positives = 26/76 (34%), Gaps = 4/76 (5%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPP----PPPPPXXXXXXXXPXXXXGGXXXXPP 689 PPPP PP +F PP PPPPP P P Sbjct: 135 PPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTP 194 Query: 690 PXPPPXXKKXXPPPPP 737 P PP + PPPPP Sbjct: 195 PPPPYKYGRVYPPPPP 210 Score = 42.3 bits (95), Expect = 5e-04 Identities = 31/116 (26%), Positives = 33/116 (28%), Gaps = 7/116 (6%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP----PPPPXXXXXXXXPXXXXGGXXXXPP 689 PPPP PP + PPP PPPP P PP Sbjct: 99 PPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLS---PPPP 155 Query: 690 PX---PPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPP 848 P PPP PPPP S PP + P PPP Sbjct: 156 PVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPP 211 Score = 37.1 bits (82), Expect = 0.019 Identities = 22/74 (29%), Positives = 23/74 (31%), Gaps = 2/74 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP PP P P G PPP PP Sbjct: 153 PPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPPP 212 Query: 702 PXXK--KXXPPPPP 737 + K PPPPP Sbjct: 213 QAARSYKRSPPPPP 226 Score = 36.3 bits (80), Expect = 0.033 Identities = 21/71 (29%), Positives = 23/71 (32%) Frame = +3 Query: 525 PPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPP 704 PPP + PP PPPPPPP PPP PP Sbjct: 179 PPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPPPQAAR----------SYKRSPPPPPPS 228 Query: 705 XXKKXXPPPPP 737 + PPPP Sbjct: 229 KYGRVYSPPPP 239 Score = 32.7 bits (71), Expect = 0.41 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 7/66 (10%) Frame = +3 Query: 573 PPXKKXIFXXXPP----PPPPPXXXXXXXXPXXXXGGXXXXPPPX---PPPXXKKXXPPP 731 PP + PP PPPPP P PPP PPP PPP Sbjct: 54 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPV----NLSPPPPPVLLSPPPPPVNLSPPP 109 Query: 732 PPXXXS 749 PP S Sbjct: 110 PPVNLS 115 Score = 31.5 bits (68), Expect = 0.94 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPPPX---PPPXXKKXXPPPPPXXXS 749 PPPPP P PPP PPP PPPPP S Sbjct: 44 PPPPPVNISSPPPPV----NLSPPPPPVNLSPPPPPVNLSPPPPPVNLS 88 Score = 31.5 bits (68), Expect = 0.94 Identities = 24/80 (30%), Positives = 24/80 (30%), Gaps = 8/80 (10%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP----PPPPXXXXXXXXPXXXXGGXXXXPP 689 PPPP PP PPP PPPP P PP Sbjct: 45 PPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLS-----PP 99 Query: 690 PXP----PPXXKKXXPPPPP 737 P P PP PPPP Sbjct: 100 PPPVNLSPPPPPVNLSPPPP 119 Score = 30.7 bits (66), Expect = 1.6 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 8/66 (12%) Frame = +3 Query: 576 PXKKXIFXXXPPPPP-----PPXXXXXXXXPXXXXGGXXXXPPPX---PPPXXKKXXPPP 731 P + PPPPP PP P PPP PPP PPP Sbjct: 34 PEPAPLVDLSPPPPPVNISSPPPPVNLSPPPPPV--NLSPPPPPVNLSPPPPPVNLSPPP 91 Query: 732 PPXXXS 749 PP S Sbjct: 92 PPVLLS 97 Score = 30.7 bits (66), Expect = 1.6 Identities = 24/80 (30%), Positives = 24/80 (30%), Gaps = 8/80 (10%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP----PPPPXXXXXXXXPXXXXGGXXXXPP 689 PPPP PP PPP PPPP P PP Sbjct: 54 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLS-----PP 108 Query: 690 PXP----PPXXKKXXPPPPP 737 P P PP PPPP Sbjct: 109 PPPVNLSPPPPPVLLSPPPP 128 Score = 30.7 bits (66), Expect = 1.6 Identities = 24/80 (30%), Positives = 24/80 (30%), Gaps = 8/80 (10%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP----PPPPXXXXXXXXPXXXXGGXXXXPP 689 PPPP PP PPP PPPP P PP Sbjct: 63 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLS-----PP 117 Query: 690 PXP----PPXXKKXXPPPPP 737 P P PP PPPP Sbjct: 118 PPPVLLSPPPPPVLLSPPPP 137 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPP 623 PPPP G PP + PPPPPP Sbjct: 194 PPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPP 227 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP + PPPPPP Sbjct: 195 PPPPYKYGRVYPPPPPPP 212 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP + PPPPPP Sbjct: 194 PPPPPYKYGRVYPPPPPP 211 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +1 Query: 685 PPPXXPXXKKKXPPPPPP 738 PPP K+ PPPPPP Sbjct: 210 PPPQAARSYKRSPPPPPP 227 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/75 (29%), Positives = 26/75 (34%), Gaps = 4/75 (5%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP----PPPXXXXXXXXPXXXXGGXXXXPP 689 PPP + PP ++ PPPP PP P PP Sbjct: 467 PPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPP 526 Query: 690 PXPPPXXKKXXPPPP 734 P PPP + PPPP Sbjct: 527 PSPPPPCPESSPPPP 541 Score = 38.7 bits (86), Expect = 0.006 Identities = 31/123 (25%), Positives = 35/123 (28%), Gaps = 11/123 (8%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPP---PPXXXXXXXXPXXXXGGXXXXPPP 692 PPPP P ++ PPPPP PP P PPP Sbjct: 495 PPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPP 554 Query: 693 XPP---PXXKKXXPPP-----PPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPP 848 P P + PPP PP S PP + P PPP Sbjct: 555 PSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPP 614 Query: 849 XXP 857 P Sbjct: 615 PSP 617 Score = 32.7 bits (71), Expect = 0.41 Identities = 21/74 (28%), Positives = 21/74 (28%), Gaps = 2/74 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPP--PX 695 PPPP PP P PPPP P PP P Sbjct: 582 PPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPS 641 Query: 696 PPPXXKKXXPPPPP 737 PPP PP P Sbjct: 642 PPPPSPVYYPPVTP 655 Score = 32.3 bits (70), Expect = 0.54 Identities = 30/115 (26%), Positives = 31/115 (26%), Gaps = 3/115 (2%) Frame = +3 Query: 522 PPPPXX--GGGXXXFXGXXPPXKKXIFXXXP-PPPPPPXXXXXXXXPXXXXGGXXXXPPP 692 PPPP + PP K PPPPPP P Sbjct: 425 PPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSP 484 Query: 693 XPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PPP PPPPP S PP P PPP P Sbjct: 485 PPPPYVYSS-PPPPPYVYSSPPPP----YVYSSPPPPYVYSSPPPPPPSPPPPCP 534 Score = 31.9 bits (69), Expect = 0.71 Identities = 23/79 (29%), Positives = 23/79 (29%), Gaps = 7/79 (8%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPP--PX 695 PPPP PP P PPPP P PP P Sbjct: 597 PPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPS 656 Query: 696 PPPXXKKXXP-----PPPP 737 PPP P PPPP Sbjct: 657 PPPPSPVYYPSETQSPPPP 675 Score = 29.5 bits (63), Expect = 3.8 Identities = 24/85 (28%), Positives = 26/85 (30%), Gaps = 9/85 (10%) Frame = +3 Query: 522 PPPPXX--GGGXXXFXGXXPPXKKX---IFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXP 686 PPPP + PP K + PPPPP P Sbjct: 408 PPPPSSKMSPTVRAYSPPPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPP 467 Query: 687 PPX----PPPXXKKXXPPPPPXXXS 749 PP PPP PPPPP S Sbjct: 468 PPYVYSSPPPPYVYSSPPPPPYVYS 492 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXK 758 PPPPPPP P P PPP + PPPPP + K Sbjct: 194 PPPPPPPGNAAIPVEPPLTMSAEKESYAPLPPPPGRAALPPPPPLPMAVRK 244 Score = 33.9 bits (74), Expect = 0.18 Identities = 22/79 (27%), Positives = 25/79 (31%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP +K + PPPP P G PP PP Sbjct: 196 PPPPPGNAAIPVEPPLTMSAEKESYAPLPPPPGRAALPPPPPLPMAVRKGVAA--PPLPP 253 Query: 702 PXXKKXXPPPPPXXXSXXK 758 P PPPPP + K Sbjct: 254 PGTAAL-PPPPPLPMAAGK 271 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXP-PPXXKK--XXPPPPP 737 PPPP P P G PPP P P K PPPPP Sbjct: 234 PPPPLPMAVRKGVAAPPLPPPGTAALPPPPPLPMAAGKGVAAPPPPP 280 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPP 704 PP PPP P G PP PPP Sbjct: 249 PPLPPPGTAALPPPPPLPMAAGKGVAAPPPPPP 281 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/45 (40%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXX--PPPXPPPXXKKXXPPPPP 737 PPPPPP P PPP PPP ++ PPPPP Sbjct: 16 PPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPP 60 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPPPP P PPP PPP + PP Sbjct: 30 PPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRPCSRPP 72 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPP 731 PP + PPPPPP P PPP PPP + PP Sbjct: 20 PPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRPCSRPP 72 Score = 34.7 bits (76), Expect = 0.10 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P ++ PPPPPP Sbjct: 31 PPPPPPLMRRRAPPPPPP 48 Score = 34.7 bits (76), Expect = 0.10 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P ++ PPPPPP Sbjct: 44 PPPPPPLMRRRAPPPPPP 61 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P ++ P PPPP Sbjct: 16 PPPPPPLMRRRAPLPPPP 33 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP ++ PPPPPP Sbjct: 32 PPPPPLMRRRAPPPPPPP 49 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP ++ PPPPPP Sbjct: 45 PPPPPLMRRRAPPPPPPP 62 Score = 30.3 bits (65), Expect = 2.2 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P + PPPPP Sbjct: 30 PPPPPPPLMRRRAPPPPP 47 Score = 30.3 bits (65), Expect = 2.2 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P + PPPPP Sbjct: 43 PPPPPPPLMRRRAPPPPP 60 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP + PPPPPP Sbjct: 18 PPPPLMRRRAPLPPPPPP 35 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP + PPPPPP Sbjct: 46 PPPPLMRRRAPPPPPPPP 63 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP PPPPPPP P PPP PPP P PP Sbjct: 35 PPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPPPPPPSAPPPLVPDPP 89 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPP 704 PPPPPP P PPP PPP Sbjct: 22 PPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPP 53 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP P P P PPP P PPPPP Sbjct: 9 PPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPP 51 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 10/58 (17%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP----------PXXKKXXPPPPPXXXS 749 PPPPPP P PPP PP P + PPPP S Sbjct: 22 PPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPPPPPPS 79 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P P PP P PPP P PPPPP Sbjct: 10 PLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPP 53 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP P PP P PPP PPPPP Sbjct: 9 PPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPP 52 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/60 (35%), Positives = 25/60 (41%), Gaps = 5/60 (8%) Frame = +3 Query: 573 PPXKKXI-FXXXPPPPPPPXXXXXXXXPXXXXGGXXXXP-PPXPPPXXKK---XXPPPPP 737 PP + + PPPPPPP P P PP PPP ++ PPPPP Sbjct: 15 PPMRGRVPLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPP 74 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/72 (27%), Positives = 21/72 (29%), Gaps = 1/72 (1%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPP-XXXXXXXXPXXXXGGXXXXPPPXP 698 PPPP PP + PPPPPPP P P Sbjct: 42 PPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPPLPMFDAEVLCCCYPPTRVRREAPLP 101 Query: 699 PPXXKKXXPPPP 734 PP PPP Sbjct: 102 PPPLIFVGAPPP 113 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P ++ P PPPP Sbjct: 27 PPPPPPPMRRRAPLPPPP 44 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P ++ PPPPP Sbjct: 28 PPPPPPMRRRAPLPPPPP 45 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P ++ P PPPP Sbjct: 41 PPPPPPPMRRRAPLPPPP 58 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P ++ PPPPP Sbjct: 42 PPPPPPMRRRAPLPPPPP 59 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/21 (52%), Positives = 13/21 (61%), Gaps = 3/21 (14%) Frame = +2 Query: 686 PPPPXPXXKK---XXPPPPPP 739 PPPP P ++ PPPPPP Sbjct: 55 PPPPPPAMRRRVLPRPPPPPP 75 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPP 704 PP +K I PPPPPPP P PPP PPP Sbjct: 303 PPPQKSI---PPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 32.3 bits (70), Expect = 0.54 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP P K PPPPPP Sbjct: 324 PPPPPSVSKAPPPPPPP 340 Score = 31.5 bits (68), Expect = 0.94 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 311 PPPPPPPPPLLQQPPPPP 328 Score = 31.5 bits (68), Expect = 0.94 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP K PPPPPP Sbjct: 324 PPPPPSVSKAPPPPPPPP 341 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPPXXXS 749 PPP PPP PPPP S Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVS 331 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP PPPPPP Sbjct: 325 PPPPSVSKAPPPPPPPPP 342 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXX 785 PPPPPPP PPP PPP PPPPP G Sbjct: 125 PPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPP------PPPPPTITPPVTTTTTGHHHH 178 Query: 786 XXXPP 800 PP Sbjct: 179 RPPPP 183 Score = 34.7 bits (76), Expect = 0.10 Identities = 26/84 (30%), Positives = 26/84 (30%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXX 785 PPPPPPP PPP PPP PPPPP G Sbjct: 97 PPPPPPPPLSAITTTGHHH---HRRSPPPPPPP------PPPPPTITPPVTTTTAGHHHH 147 Query: 786 XXXPPXXXXXFXFXXXPXPPPXXP 857 PP P PPP P Sbjct: 148 RRSPP---------PPPPPPPPPP 162 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/70 (27%), Positives = 20/70 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP G + PPPPPP PPP PP Sbjct: 98 PPPPPPPLSAITTTGHHHHRRSPPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPP 157 Query: 702 PXXKKXXPPP 731 P PP Sbjct: 158 PPPPPTITPP 167 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPPPPP G PPP PP Sbjct: 154 PPPPPPPPPTITPPVTTTTTGHHHHRPPPPPP 185 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 37.9 bits (84), Expect = 0.011 Identities = 24/77 (31%), Positives = 24/77 (31%), Gaps = 2/77 (2%) Frame = +3 Query: 510 GGGXP--PPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXX 683 GGG PPP PP PPPP PP P Sbjct: 39 GGGNDNNPPPSPSPEPEPEPADCPPPPPP--PPCPPPPSPPPCPPPPSPPPSPPPPQLPP 96 Query: 684 PPPXPPPXXKKXXPPPP 734 PP PPP K P PP Sbjct: 97 PPQLPPPAPPKPQPSPP 113 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPPP P PPP P + PP PP Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPPP P PPP PPP PPPP Sbjct: 62 PPPPPPPPCPPPPSPP-------PCPPPPSPPPSPPPPQLPPPP 98 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPPXXXS 749 PPP PPP PPP P S Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPS 84 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 37.5 bits (83), Expect = 0.014 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP PPPPPPP P PP PP + PPPPP Sbjct: 40 PPVYSPPISPPPPPPPPP--------PQSHAAAYKRYSPPPPPSKYGRVYPPPPP 86 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP PPPPPP Sbjct: 37 PPPPPVYSPPISPPPPPP 54 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 37.5 bits (83), Expect = 0.014 Identities = 22/74 (29%), Positives = 25/74 (33%), Gaps = 2/74 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP--PPPXXXXXXXXPXXXXGGXXXXPPPX 695 PPPP + PP + PP P PPP P PP Sbjct: 98 PPPPTVKPPPPPYV--KPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPP 155 Query: 696 PPPXXKKXXPPPPP 737 P P + PPPPP Sbjct: 156 PTPTPEAPCPPPPP 169 Score = 31.9 bits (69), Expect = 0.71 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXP---PPXXKKXXPPPPP 737 P K PP PP P PPP P PP PPPPP Sbjct: 52 PTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPP 109 Score = 30.7 bits (66), Expect = 1.6 Identities = 22/75 (29%), Positives = 23/75 (30%), Gaps = 3/75 (4%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP--PPPXXXXXXXXPXXXXGGXXXXP-PP 692 PPPP PP + PP P PPP P P P Sbjct: 106 PPPPYVKPPPPPTVKPPPPPTP--YTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAP 163 Query: 693 XPPPXXKKXXPPPPP 737 PPP PPP P Sbjct: 164 CPPPPPTPYPPPPKP 178 Score = 29.9 bits (64), Expect = 2.9 Identities = 23/76 (30%), Positives = 23/76 (30%), Gaps = 5/76 (6%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPP---PPXXXXXXXXPXXXXGGXXXXPPP 692 P PP PP PPPPP PP P PPP Sbjct: 61 PKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYV---KPPPPP 117 Query: 693 X--PPPXXKKXXPPPP 734 PPP PPPP Sbjct: 118 TVKPPPPPTPYTPPPP 133 Score = 29.5 bits (63), Expect = 3.8 Identities = 20/71 (28%), Positives = 22/71 (30%), Gaps = 3/71 (4%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPP---PPPPPXXXXXXXXPXXXXGGXXXXPPP 692 PPPP PP + PP PPPPP P P P Sbjct: 114 PPPPTVKPPPPPTPYTPPPPTP--YTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTP 171 Query: 693 XPPPXXKKXXP 725 PPP + P Sbjct: 172 YPPPPKPETCP 182 Score = 28.7 bits (61), Expect = 6.6 Identities = 20/74 (27%), Positives = 21/74 (28%), Gaps = 4/74 (5%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX-- 695 PPPP + P K PPPPP PPP Sbjct: 68 PPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTP 127 Query: 696 --PPPXXKKXXPPP 731 PPP PPP Sbjct: 128 YTPPPPTPYTPPPP 141 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 37.5 bits (83), Expect = 0.014 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = +3 Query: 513 GGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPP 692 GG PPPP GG PP PPPP P GG PP Sbjct: 249 GGPPPPPHIGGS-----APPPPHM-----GGSAPPPPHMGQNYGPPPPNNMGGPRHPPPY 298 Query: 693 XPPPXXKKXXPPPP 734 PP P PP Sbjct: 299 GAPPQNNMGGPRPP 312 Score = 33.1 bits (72), Expect = 0.31 Identities = 26/84 (30%), Positives = 27/84 (32%), Gaps = 9/84 (10%) Frame = +3 Query: 510 GGGXPPPPXXGGG----XXXFXGXXPPXKKXIFXXXPPPP--PPPXXXXXXXXPXXXXGG 671 GG PPPP GG PP + PPP PP P GG Sbjct: 258 GGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPPPYGAPPQNNMGGPRPPQNYGG 317 Query: 672 XXXXPPP---XPPPXXKKXXPPPP 734 PPP PP PPP Sbjct: 318 ---TPPPNYGGAPPANNMGGAPPP 338 >At1g53260.1 68414.m06035 hypothetical protein low similarity to SP|Q38732 DAG protein, chloroplast precursor {Antirrhinum majus} Length = 358 Score = 37.5 bits (83), Expect = 0.014 Identities = 24/84 (28%), Positives = 25/84 (29%), Gaps = 9/84 (10%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP---------PPPPXXXXXXXXPXXX 662 GG PPPP G PP + PPP PP P P Sbjct: 200 GGAPPPPPHIGNNPNMPPHIQPPNMNQNYRGPPPPPNMNQNYQGPPAPNMNQNYQGPPPS 259 Query: 663 XGGXXXXPPPXPPPXXKKXXPPPP 734 G PP P PPPP Sbjct: 260 NMGQNYQGPPPPNMNQSYQGPPPP 283 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/71 (28%), Positives = 23/71 (32%) Frame = +3 Query: 525 PPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPP 704 PPP G + G PP + PPPP P G P PPP Sbjct: 256 PPPSNMG--QNYQGPPPPNMNQSYQG----PPPPNMNQSYQGPPPSNMGQNYRGPSLPPP 309 Query: 705 XXKKXXPPPPP 737 + PPP Sbjct: 310 NMSQNYEGPPP 320 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXP---PPPP 737 PPPPPPP P PP PPP P PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPP 94 Score = 35.9 bits (79), Expect = 0.044 Identities = 20/53 (37%), Positives = 22/53 (41%), Gaps = 4/53 (7%) Frame = +3 Query: 591 IFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPP----XXKKXXPPPPP 737 +F PPPPPPP P PPP PPP + PPPPP Sbjct: 37 LFPQSPPPPPPPPPPPPPPPP----------PPPPPPPAVNMSVETGIPPPPP 79 Score = 35.1 bits (77), Expect = 0.076 Identities = 21/73 (28%), Positives = 22/73 (30%), Gaps = 1/73 (1%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPP-PXXXXXXXXPXXXXGGXXXXPPPXP 698 PPPP P + PPPPPP P PPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKP 106 Query: 699 PPXXKKXXPPPPP 737 P PPPP Sbjct: 107 PQKNLPRRHPPPP 119 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PPP PPP PPPPP G PP PPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPAVNMSVETG---IPPPPPPVTDMIKPLSSPPPPQPP 97 Score = 32.3 bits (70), Expect = 0.54 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPP 59 Score = 29.1 bits (62), Expect = 5.0 Identities = 18/67 (26%), Positives = 20/67 (29%), Gaps = 2/67 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXX--PPPPPPPXXXXXXXXPXXXXGGXXXXPPPX 695 PPPP PP + PPPP PP P PPP Sbjct: 61 PPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPPQKNLPRRHPPPPR 120 Query: 696 PPPXXKK 716 P K+ Sbjct: 121 SPEKPKR 127 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/88 (29%), Positives = 29/88 (32%), Gaps = 12/88 (13%) Frame = +3 Query: 522 PPPPXX--GGGXXXFXGXXPPXKKXIFXXXPPPP------PPPXXXXXXXXPXXXXGGXX 677 PPPP + PP ++ PPPP PPP P Sbjct: 101 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSP 160 Query: 678 XXPP----PXPPPXXKKXXPPPPPXXXS 749 PP P PPP PPPPP S Sbjct: 161 PPPPYVYSPPPPPPYVYQSPPPPPYVYS 188 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/88 (29%), Positives = 29/88 (32%), Gaps = 12/88 (13%) Frame = +3 Query: 522 PPPPXXGGGXXX--FXGXXPPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXX 680 PPPP + PP ++ PPPP PPP P Sbjct: 141 PPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSP 200 Query: 681 XPPPX-----PPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 201 PPPPYVYSSPPPPPYVYKSPPPPPYVYS 228 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/88 (29%), Positives = 29/88 (32%), Gaps = 12/88 (13%) Frame = +3 Query: 522 PPPPXXGGGXXX--FXGXXPPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXX 680 PPPP + PP ++ PPPP PPP P Sbjct: 181 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 240 Query: 681 XPPPX-----PPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 241 PPPPYVYSSPPPPPYVYKSPPPPPYVYS 268 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/88 (29%), Positives = 29/88 (32%), Gaps = 12/88 (13%) Frame = +3 Query: 522 PPPPXXGGGXXX--FXGXXPPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXX 680 PPPP + PP ++ PPPP PPP P Sbjct: 201 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 260 Query: 681 XPPPX-----PPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 261 PPPPYVYSSPPPPPYVYKSPPPPPYVYS 288 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/88 (29%), Positives = 29/88 (32%), Gaps = 12/88 (13%) Frame = +3 Query: 522 PPPPXXGGGXXX--FXGXXPPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXX 680 PPPP + PP ++ PPPP PPP P Sbjct: 221 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 280 Query: 681 XPPPX-----PPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 281 PPPPYVYSSPPPPPYVYSSPPPPPYVYS 308 Score = 37.1 bits (82), Expect = 0.019 Identities = 25/84 (29%), Positives = 28/84 (33%), Gaps = 13/84 (15%) Frame = +3 Query: 522 PPPPXXGGGXXX--FXGXXPPXKKXIFXXXPPPP------PPPXXXXXXXXPXXXXGGXX 677 PPPP + PP ++ PPPP PPP P Sbjct: 241 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSP 300 Query: 678 XXPP-----PXPPPXXKKXXPPPP 734 PP P PPP K PPPP Sbjct: 301 PPPPYVYSSPPPPPYVYKSPPPPP 324 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/88 (29%), Positives = 29/88 (32%), Gaps = 12/88 (13%) Frame = +3 Query: 522 PPPPXXGGGXXX--FXGXXPPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXX 680 PPPP + PP ++ PPPP PPP P Sbjct: 261 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSP 320 Query: 681 XPPPX-----PPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 321 PPPPYVYTSPPPPPYVYKSPPPPPYVDS 348 Score = 36.7 bits (81), Expect = 0.025 Identities = 26/88 (29%), Positives = 29/88 (32%), Gaps = 12/88 (13%) Frame = +3 Query: 522 PPPPXX--GGGXXXFXGXXPPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXX 680 PPPP + PP ++ PPPP PPP P Sbjct: 121 PPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSP 180 Query: 681 XPPPX-----PPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 181 PPPPYVYSSPPPPPYVYKSPPPPPYVYS 208 Score = 36.7 bits (81), Expect = 0.025 Identities = 26/88 (29%), Positives = 29/88 (32%), Gaps = 12/88 (13%) Frame = +3 Query: 522 PPPPXX--GGGXXXFXGXXPPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXX 680 PPPP + PP ++ PPPP PPP P Sbjct: 211 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 270 Query: 681 XPPPX-----PPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 271 PPPPYVYKSPPPPPYVYSSPPPPPYVYS 298 Score = 36.3 bits (80), Expect = 0.033 Identities = 26/86 (30%), Positives = 29/86 (33%), Gaps = 10/86 (11%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXXXP 686 PPPP + PP ++ PPPP PPP P P Sbjct: 169 PPPPPP------YVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 222 Query: 687 PPX-----PPPXXKKXXPPPPPXXXS 749 PP PPP PPPPP S Sbjct: 223 PPYVYSSPPPPPYVYKSPPPPPYVYS 248 Score = 33.9 bits (74), Expect = 0.18 Identities = 24/85 (28%), Positives = 27/85 (31%), Gaps = 13/85 (15%) Frame = +3 Query: 522 PPPPXX--GGGXXXFXGXXPPXKKXIFXXXPPPP------PPPXXXXXXXXPXXXXGGXX 677 PPPP + PP ++ PPPP PPP P Sbjct: 271 PPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSP 330 Query: 678 XXPP-----PXPPPXXKKXXPPPPP 737 PP P PPP PPP P Sbjct: 331 PPPPYVYKSPPPPPYVDSYSPPPAP 355 Score = 32.3 bits (70), Expect = 0.54 Identities = 21/79 (26%), Positives = 24/79 (30%), Gaps = 8/79 (10%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXP----PPPPPPXXXXXXXXPXXXXGGXXXXP- 686 P PP + P ++ P PPPPP P P Sbjct: 36 PLPPYVYNSPPPYVYNSPSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPY 95 Query: 687 ---PPXPPPXXKKXXPPPP 734 P PPP K PPPP Sbjct: 96 VYSSPPPPPYVYKSPPPPP 114 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/88 (29%), Positives = 29/88 (32%), Gaps = 12/88 (13%) Frame = +3 Query: 522 PPPPXXGGGXXX--FXGXXPPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXX 680 PPPP + PP ++ PPPP PPP P Sbjct: 71 PPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSP 130 Query: 681 XPPPX-----PPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 131 PPPPYVYNSPPPPPYVYKSPPPPPYVYS 158 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/88 (29%), Positives = 29/88 (32%), Gaps = 12/88 (13%) Frame = +3 Query: 522 PPPPXXGGGXXX--FXGXXPPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXX 680 PPPP + PP ++ PPPP PPP P Sbjct: 91 PPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSP 150 Query: 681 XPPPX-----PPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 151 PPPPYVYSSPPPPPYVYKSPPPPPYVYS 178 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/88 (29%), Positives = 29/88 (32%), Gaps = 12/88 (13%) Frame = +3 Query: 522 PPPPXXGGGXXX--FXGXXPPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXX 680 PPPP + PP ++ PPPP PPP P Sbjct: 111 PPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 170 Query: 681 XPPPX-----PPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 171 PPPPYVYSSPPPPPYVYKSPPPPPYVYS 198 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/88 (29%), Positives = 29/88 (32%), Gaps = 12/88 (13%) Frame = +3 Query: 522 PPPPXXGGGXXX--FXGXXPPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXX 680 PPPP + PP ++ PPPP PPP P Sbjct: 131 PPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 190 Query: 681 XPPPX-----PPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 191 PPPPYVYSSPPPPPYVYKSPPPPPYVYS 218 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/88 (29%), Positives = 29/88 (32%), Gaps = 12/88 (13%) Frame = +3 Query: 522 PPPPXXGGGXXX--FXGXXPPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXX 680 PPPP + PP ++ PPPP PPP P Sbjct: 151 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 210 Query: 681 XPPPX-----PPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 211 PPPPYVYSSPPPPPYVYKSPPPPPYVYS 238 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/88 (29%), Positives = 29/88 (32%), Gaps = 12/88 (13%) Frame = +3 Query: 522 PPPPXXGGGXXX--FXGXXPPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXX 680 PPPP + PP ++ PPPP PPP P Sbjct: 171 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 230 Query: 681 XPPPX-----PPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 231 PPPPYVYSSPPPPPYVYKSPPPPPYVYS 258 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/88 (29%), Positives = 29/88 (32%), Gaps = 12/88 (13%) Frame = +3 Query: 522 PPPPXXGGGXXX--FXGXXPPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXX 680 PPPP + PP ++ PPPP PPP P Sbjct: 191 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 250 Query: 681 XPPPX-----PPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 251 PPPPYVYSSPPPPPYVYKSPPPPPYVYS 278 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/88 (29%), Positives = 29/88 (32%), Gaps = 12/88 (13%) Frame = +3 Query: 522 PPPPXXGGGXXX--FXGXXPPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXX 680 PPPP + PP ++ PPPP PPP P Sbjct: 211 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 270 Query: 681 XPPPX-----PPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 271 PPPPYVYSSPPPPPYVYKSPPPPPYVYS 298 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/88 (29%), Positives = 29/88 (32%), Gaps = 12/88 (13%) Frame = +3 Query: 522 PPPPXXGGGXXX--FXGXXPPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXX 680 PPPP + PP ++ PPPP PPP P Sbjct: 231 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 290 Query: 681 XPPPX-----PPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 291 PPPPYVYSSPPPPPYVYKSPPPPPYVYS 318 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/88 (29%), Positives = 29/88 (32%), Gaps = 12/88 (13%) Frame = +3 Query: 522 PPPPXXGGGXXX--FXGXXPPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXX 680 PPPP + PP ++ PPPP PPP P Sbjct: 271 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 330 Query: 681 XPPPX-----PPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 331 PPPPYVYNSPPPPPYVYKSPPPPPYVYS 358 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/88 (29%), Positives = 29/88 (32%), Gaps = 12/88 (13%) Frame = +3 Query: 522 PPPPXXGGGXXX--FXGXXPPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXX 680 PPPP + PP ++ PPPP PPP P Sbjct: 311 PPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSP 370 Query: 681 XPPPX-----PPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 371 PPPPYVYSSPPPPPYVYKSPPPPPYVYS 398 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/88 (29%), Positives = 29/88 (32%), Gaps = 12/88 (13%) Frame = +3 Query: 522 PPPPXXGGGXXX--FXGXXPPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXX 680 PPPP + PP ++ PPPP PPP P Sbjct: 351 PPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 410 Query: 681 XPPPX-----PPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 411 PPPPYVYSSPPPPPYVYKSPPPPPYVYS 438 Score = 36.7 bits (81), Expect = 0.025 Identities = 25/84 (29%), Positives = 28/84 (33%), Gaps = 13/84 (15%) Frame = +3 Query: 522 PPPPXX--GGGXXXFXGXXPPXKKXIFXXXPPPP------PPPXXXXXXXXPXXXXGGXX 677 PPPP + PP ++ PPPP PPP P Sbjct: 381 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 440 Query: 678 XXPP-----PXPPPXXKKXXPPPP 734 PP P PPP K PPPP Sbjct: 441 PPPPYVYKSPSPPPYVYKSPPPPP 464 Score = 36.3 bits (80), Expect = 0.033 Identities = 25/84 (29%), Positives = 28/84 (33%), Gaps = 13/84 (15%) Frame = +3 Query: 522 PPPPXXGGGXXX--FXGXXPPXKKXIFXXXPPPP------PPPXXXXXXXXPXXXXGGXX 677 PPPP + PP ++ PPPP PPP P Sbjct: 51 PPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSP 110 Query: 678 XXPP-----PXPPPXXKKXXPPPP 734 PP P PPP K PPPP Sbjct: 111 PPPPYVYSSPPPPPYVYKSPPPPP 134 Score = 35.5 bits (78), Expect = 0.058 Identities = 25/82 (30%), Positives = 28/82 (34%), Gaps = 10/82 (12%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXXXP 686 PPPP + PP ++ PPPP PPP P P Sbjct: 370 PPPPP-------YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 422 Query: 687 PPX-----PPPXXKKXXPPPPP 737 PP PPP PPPPP Sbjct: 423 PPYVYKSPPPPPYVYSSPPPPP 444 Score = 34.7 bits (76), Expect = 0.10 Identities = 21/65 (32%), Positives = 23/65 (35%), Gaps = 11/65 (16%) Frame = +3 Query: 573 PPXKKXIFXXXPPPP------PPPXXXXXXXXPXXXXGGXXXXPP-----PXPPPXXKKX 719 PP ++ PPPP PPP P PP P PPP K Sbjct: 50 PPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKS 109 Query: 720 XPPPP 734 PPPP Sbjct: 110 PPPPP 114 Score = 34.7 bits (76), Expect = 0.10 Identities = 24/84 (28%), Positives = 27/84 (32%), Gaps = 13/84 (15%) Frame = +3 Query: 522 PPPPXX--GGGXXXFXGXXPPXKKXIFXXXPPPP------PPPXXXXXXXXPXXXXGGXX 677 PPPP + PP ++ PPPP PPP P Sbjct: 241 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 300 Query: 678 XXPP-----PXPPPXXKKXXPPPP 734 PP P PPP PPPP Sbjct: 301 PPPPYVYKSPPPPPYVYSSPPPPP 324 Score = 33.9 bits (74), Expect = 0.18 Identities = 25/88 (28%), Positives = 28/88 (31%), Gaps = 12/88 (13%) Frame = +3 Query: 522 PPPPXXGGGXXX--FXGXXPPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXX 680 PPPP + PP ++ PP P PPP P Sbjct: 331 PPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSP 390 Query: 681 XPPPX-----PPPXXKKXXPPPPPXXXS 749 PPP PPP PPPPP S Sbjct: 391 PPPPYVYSSPPPPPYVYKSPPPPPYVYS 418 Score = 30.7 bits (66), Expect = 1.6 Identities = 22/79 (27%), Positives = 25/79 (31%), Gaps = 8/79 (10%) Frame = +3 Query: 522 PPPPXX--GGGXXXFXGXXPPXKKXIFXXXPPPP------PPPXXXXXXXXPXXXXGGXX 677 PPPP + PP ++ PPPP PPP P Sbjct: 401 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYV---Y 457 Query: 678 XXPPPXPPPXXKKXXPPPP 734 PPP P PPPP Sbjct: 458 KSPPPPPSYSYSYSSPPPP 476 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 36.7 bits (81), Expect = 0.025 Identities = 21/59 (35%), Positives = 23/59 (38%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXP 698 PPP GGG P + + PPPPPPP P GG PPP P Sbjct: 654 PPPRSAGGGKST---NLPSARPPLPGGGPPPPPPPPGGGPPPPP----GGGPPPPPPPP 705 Score = 35.5 bits (78), Expect = 0.058 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPP 626 GGG PPPP GG G PP PPPPPPP Sbjct: 676 GGGPPPPPPPPGG-----GPPPPP-----GGGPPPPPPP 704 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPP 623 GG PPPP GGG G PP PPPPPP Sbjct: 677 GGPPPPPPPPGGGPPPPPGGGPP---------PPPPPP 705 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +3 Query: 651 PXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPP 800 P GG P PP PPPPP GG PP Sbjct: 656 PRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 26.2 bits (55), Expect(2) = 5.4 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -1 Query: 547 PPPXXGGGGXPPP 509 PPP GGG PPP Sbjct: 682 PPPPPGGGPPPPP 694 Score = 21.0 bits (42), Expect(2) = 5.4 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -1 Query: 565 PXKXXXPPPXXGGGG 521 P + PPP GGG Sbjct: 648 PPRVPRPPPRSAGGG 662 >At2g43800.1 68415.m05445 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 894 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +3 Query: 573 PPXKKXIFXXX--PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPP 704 PP +K +F PPPPPP P PPP PPP Sbjct: 74 PPHEKHLFSSVANPPPPPPSPPHPNPFFPSSDPTSTASHPPPAPPP 119 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 36.7 bits (81), Expect = 0.025 Identities = 26/95 (27%), Positives = 26/95 (27%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSX 752 PP K PPPPPPP PPP PPPPP S Sbjct: 560 PPLKPLRILSRPPPPPPPPPISSLRSTPSPSSTSNSIATQGPPP------PPPPPPLQSH 613 Query: 753 XKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PP P PPP P Sbjct: 614 RSALSSS----PLPPPLPPKKLLATTNPPPPPPPP 644 Score = 35.1 bits (77), Expect = 0.076 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPX---KKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPP 692 PPPP PP KK + PPPPPPP PP Sbjct: 606 PPPPLQSHRSALSSSPLPPPLPPKKLLATTNPPPPPPPPLHSNSRMGAPTSSLVLKSPPV 665 Query: 693 XPPP 704 PPP Sbjct: 666 PPPP 669 >At5g02600.2 68418.m00195 heavy-metal-associated domain-containing protein low similarity to gi:3168840 copper homeostasis factor; contains Pfam heavy-metal-associated domain PF00403; predicted proteins, Arabidopsis thaliana Length = 319 Score = 30.3 bits (65), Expect(2) = 0.031 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPPXXXS 749 PPP PPP + PP PP S Sbjct: 225 PPPPPPPSPPQSSPPSPPEKNS 246 Score = 25.0 bits (52), Expect(2) = 0.031 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 594 FXXXPPPPPPP 626 F PPPPPPP Sbjct: 221 FKFSPPPPPPP 231 >At5g02600.1 68418.m00196 heavy-metal-associated domain-containing protein low similarity to gi:3168840 copper homeostasis factor; contains Pfam heavy-metal-associated domain PF00403; predicted proteins, Arabidopsis thaliana Length = 319 Score = 30.3 bits (65), Expect(2) = 0.031 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPPXXXS 749 PPP PPP + PP PP S Sbjct: 225 PPPPPPPSPPQSSPPSPPEKNS 246 Score = 25.0 bits (52), Expect(2) = 0.031 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 594 FXXXPPPPPPP 626 F PPPPPPP Sbjct: 221 FKFSPPPPPPP 231 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPP-----PXPPPXXKKXXPPPPP 737 PPPPP P P PP P PPP PPPPP Sbjct: 768 PPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPP 816 Score = 32.7 bits (71), Expect = 0.41 Identities = 19/61 (31%), Positives = 21/61 (34%), Gaps = 6/61 (9%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPP--XPPPXXK----KXXPPPP 734 PP + P PPPPP P P P PPP + PPPP Sbjct: 702 PPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPP 761 Query: 735 P 737 P Sbjct: 762 P 762 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 4/59 (6%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXP---PPXPP-PXXKKXXPPPPP 737 PP ++ PPPPP P P P PP P PPPPP Sbjct: 779 PPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPPIPGISYASPPPPP 837 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXS 749 PP PPPPP P P PP PP PPP P S Sbjct: 724 PPPTPTYHYISPPPPPTPIHSP----PPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYS 778 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPP P PPP PP PPPP Sbjct: 758 PPPPPTVHYNPPPPPSPA---HYSPPPSPPVYYYNSPPPPP 795 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPP Sbjct: 702 PPPPAPYYYSSPQPPPPP 719 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 36.3 bits (80), Expect = 0.033 Identities = 24/79 (30%), Positives = 24/79 (30%), Gaps = 7/79 (8%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPP---PPXXXXXXXXPXXXXGGXXXXPPP 692 PPPP PP PPPP PP P PPP Sbjct: 677 PPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPP 736 Query: 693 XP----PPXXKKXXPPPPP 737 P PP PPPPP Sbjct: 737 PPVFSPPPPAPIYSPPPPP 755 Score = 33.5 bits (73), Expect = 0.23 Identities = 32/118 (27%), Positives = 33/118 (27%), Gaps = 9/118 (7%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP---PPPXXXXXXXXPXXXXGGXXXXPPP 692 PPPP PP PPPP PPP P PPP Sbjct: 648 PPPPPVHSPPPPVFSPPPPMHS------PPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPP 701 Query: 693 ---XPPPXXKKXXPP---PPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPP 848 PPP PP PPP S PP + P PPP Sbjct: 702 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIY----SPPPPP 755 Score = 31.9 bits (69), Expect = 0.71 Identities = 21/74 (28%), Positives = 22/74 (29%), Gaps = 2/74 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP--PPPPXXXXXXXXPXXXXGGXXXXPPPX 695 PPPP PP I+ PPP PPP P PPP Sbjct: 727 PPPPVQSPPPPPVFSPPPPAP--IYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPP 784 Query: 696 PPPXXKKXXPPPPP 737 PPPP Sbjct: 785 VHSPPPPVHSPPPP 798 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 5/49 (10%) Frame = +3 Query: 606 PPPPP---PPXXXXXXXXPXXXXGGXXXXPPPX--PPPXXKKXXPPPPP 737 PPPPP PP P PPP PP PPPP Sbjct: 766 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPP 814 Score = 28.7 bits (61), Expect = 6.6 Identities = 19/72 (26%), Positives = 20/72 (27%), Gaps = 2/72 (2%) Frame = +3 Query: 525 PPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXP-- 698 PPP PP + PPPP P PPP P Sbjct: 713 PPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVH 772 Query: 699 PPXXKKXXPPPP 734 P PPPP Sbjct: 773 SPPPPVHSPPPP 784 Score = 28.3 bits (60), Expect = 8.8 Identities = 21/92 (22%), Positives = 22/92 (23%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSX 752 PP + PP PP P PPP P PPP S Sbjct: 647 PPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSP 706 Query: 753 XKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPP 848 PP P PPP Sbjct: 707 PPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPP 738 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPPP PPP PPP K P PPP Sbjct: 243 PPPPPPPPIPVKQSAT----------PPPPPPPKLKNNGPSPPP 276 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPPP P PPP PP PPPP Sbjct: 244 PPPPPPPIPVKQSATP----------PPPPPPKLKNNGPSPPPP 277 Score = 33.5 bits (73), Expect = 0.23 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P + PPPPPP Sbjct: 247 PPPPIPVKQSATPPPPPP 264 Score = 31.9 bits (69), Expect = 0.71 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P K P PPPP Sbjct: 260 PPPPPPKLKNNGPSPPPP 277 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKK 716 PPPPP P P P P PPP KK Sbjct: 246 PPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPPLKK 282 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 3/21 (14%) Frame = +2 Query: 686 PPPPXPXXKK---XXPPPPPP 739 PPPP P K PPPPPP Sbjct: 259 PPPPPPPKLKNNGPSPPPPPP 279 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP + PPPPP P PPP PPP PPPPP Sbjct: 1080 PPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPP------PPPPP 1128 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 4/51 (7%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPP----PXPPPXXKKXXPPPPPXXXS 749 PPPP P P PP P PPP PPPPP S Sbjct: 1079 PPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPPS 1129 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PP PPPPP P PPP PP PPPP Sbjct: 1079 PPPPSPPLPPSSLPPPPPAALFPPLPPPP----SQPPPPPLSPPPSPPPPPPPP 1128 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXP-----PPXPPPXXKKXXPPPPP 737 PPP PP P P PP PPP + PPPPP Sbjct: 1069 PPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQ---PPPPP 1114 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 35.9 bits (79), Expect = 0.044 Identities = 25/87 (28%), Positives = 25/87 (28%), Gaps = 3/87 (3%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPP---PPPXXXSXXKXXXXGG 776 PPPPPPP P PP PPP PP PPP S Sbjct: 533 PPPPPPPVHSPPP--PVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPP 590 Query: 777 XXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PP PPP P Sbjct: 591 PPVHSPPPPAPVHSPPPPVHSPPPPPP 617 Score = 32.3 bits (70), Expect = 0.54 Identities = 24/81 (29%), Positives = 24/81 (29%), Gaps = 5/81 (6%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP--PPPXXXXXXXXPXXXXGGXXXXPPPX 695 PPPP PP PPPP PP P PPP Sbjct: 543 PPPPVHSPPPPPVYSPPPPPPPV---HSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPP 599 Query: 696 PP---PXXKKXXPPPPPXXXS 749 P P PPPPP S Sbjct: 600 APVHSPPPPVHSPPPPPPVYS 620 Score = 31.5 bits (68), Expect = 0.94 Identities = 22/82 (26%), Positives = 23/82 (28%), Gaps = 6/82 (7%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP------PPPXXXXXXXXPXXXXGGXXXX 683 PPPP + P PPPP PPP P Sbjct: 568 PPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFS 627 Query: 684 PPPXPPPXXKKXXPPPPPXXXS 749 PPP P PP PP S Sbjct: 628 PPPSQSPPVVYSPPPRPPKINS 649 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPX--PPPXXKKXXPPPPPXXXS 749 PPP P P PPP PPP PPPPP S Sbjct: 518 PPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHS 567 Score = 29.5 bits (63), Expect = 3.8 Identities = 21/74 (28%), Positives = 21/74 (28%), Gaps = 2/74 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPP--PXXXXXXXXPXXXXGGXXXXPPPX 695 PPPP PP PPPPPP P PPP Sbjct: 589 PPPPVHSPPPPAPVHSPPPP-----VHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPR 643 Query: 696 PPPXXKKXXPPPPP 737 PP PPP Sbjct: 644 PPKINSPPVQSPPP 657 Score = 28.3 bits (60), Expect = 8.8 Identities = 14/55 (25%), Positives = 16/55 (29%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P + + PP P P P PPP PPPPP Sbjct: 485 PVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPP 539 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +3 Query: 582 KKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 KK PPPPPPP PP P P PPPPP Sbjct: 682 KKPALPRPPPPPPPPPMQHSTVTKVPPP--PPPAPPAPPTPIVHTSSPPPPP 731 Score = 34.3 bits (75), Expect = 0.13 Identities = 23/89 (25%), Positives = 23/89 (25%), Gaps = 5/89 (5%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPP-----XPPPXXKKXXPPPPPXXXSXXKXXXX 770 PPPPPP P P P PPP PP PP S Sbjct: 692 PPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMK 751 Query: 771 GGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PP P PP P Sbjct: 752 SSPPAPPAPPRLPTHSASPPPPTAPPPPP 780 Score = 33.5 bits (73), Expect = 0.23 Identities = 22/80 (27%), Positives = 24/80 (30%), Gaps = 9/80 (11%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKX-----IFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXP 686 PPPP PP + PPPPPPP P Sbjct: 694 PPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSS 753 Query: 687 PPXPPPXXK----KXXPPPP 734 PP PP + PPPP Sbjct: 754 PPAPPAPPRLPTHSASPPPP 773 Score = 32.7 bits (71), Expect = 0.41 Identities = 26/102 (25%), Positives = 27/102 (26%), Gaps = 10/102 (9%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPP----------XXKKXX 722 PP + PPPPPP P PPP PPP K Sbjct: 696 PPMQHSTVTKVPPPPPPAPPAPPT--PIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSS 753 Query: 723 PPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPP 848 PP PP PP P PPP Sbjct: 754 PPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPPP 795 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 35.5 bits (78), Expect = 0.058 Identities = 25/92 (27%), Positives = 25/92 (27%), Gaps = 4/92 (4%) Frame = +3 Query: 594 FXXXPPPPP----PPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKX 761 F PPPPP PP P P PPP PPPPP S Sbjct: 489 FRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPP 548 Query: 762 XXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PP P PP P Sbjct: 549 VHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 580 Score = 35.5 bits (78), Expect = 0.058 Identities = 25/82 (30%), Positives = 27/82 (32%), Gaps = 6/82 (7%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPP--- 692 PPPP PP ++ PPPPPP P PPP Sbjct: 501 PPPPSPIHSPPPPPVYSPPPPPPVYS---PPPPPPVYSPPPPPPVHSPPPPVHSPPPPVH 557 Query: 693 XPPPXXKKXXPP---PPPXXXS 749 PPP PP PPP S Sbjct: 558 SPPPPVHSPPPPVHSPPPPVHS 579 Score = 35.5 bits (78), Expect = 0.058 Identities = 31/115 (26%), Positives = 31/115 (26%), Gaps = 6/115 (5%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP---PPPXXXXXXXXPXXXXGGXXXXPPP 692 PPPP P PPPP PPP P PPP Sbjct: 545 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPP 604 Query: 693 X---PPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPP 848 PPP PPPPP S PP P PPP Sbjct: 605 PVHSPPPPVYS--PPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPP 657 Score = 35.5 bits (78), Expect = 0.058 Identities = 24/79 (30%), Positives = 24/79 (30%), Gaps = 8/79 (10%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPP-----PPXXXXXXXXPXXXXGGXXXXP 686 PPPP PP PPPP PP P P Sbjct: 587 PPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSP 646 Query: 687 PP---XPPPXXKKXXPPPP 734 PP PPP K PPPP Sbjct: 647 PPPVYSPPPPPVKSPPPPP 665 Score = 34.7 bits (76), Expect = 0.10 Identities = 25/85 (29%), Positives = 27/85 (31%), Gaps = 9/85 (10%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP--PPPXXXXXXXXPXXXXGGXXXXPPPX 695 PPPP PP ++ PPPP PP P PPP Sbjct: 510 PPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 569 Query: 696 ----PPPXXKKXXP---PPPPXXXS 749 PPP P PPPP S Sbjct: 570 VHSPPPPVHSPPPPVYSPPPPPVHS 594 Score = 28.3 bits (60), Expect = 8.8 Identities = 20/75 (26%), Positives = 23/75 (30%), Gaps = 3/75 (4%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP---PPPPXXXXXXXXPXXXXGGXXXXPPP 692 PPPP + PP ++ PPP PPPP P P Sbjct: 632 PPPPVHSPPPPVY-SPPPP----VYSPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTPVN 686 Query: 693 XPPPXXKKXXPPPPP 737 PPP PP Sbjct: 687 SPPPRTPSQTVEAPP 701 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 35.1 bits (77), Expect = 0.076 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXG----GXXXXPPPXPPPXXKKXXPPPPP 737 PPPPP P G PPP PPP + PP PP Sbjct: 356 PPPPPPLDMHPPHPGMFVGHLIPRPPYGPPPGPPPMMRPPLPPGPP 401 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 5/60 (8%) Frame = +3 Query: 573 PPXKKXIFXXXPPP----PPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXX-PPPPP 737 PP F PPP PP P P G PPP PPP + P PPP Sbjct: 348 PPPGMLRFPPPPPPLDMHPPHPGMFVGHLIPRPPYG-----PPPGPPPMMRPPLPPGPPP 402 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPP P P PPP + PPPPP Sbjct: 318 PPPPAPLHQQHQSTFAGAAASLTNFQPDVHPPPGMLRFPPPPPP 361 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP P PPPPP PP PPP + PPPP Sbjct: 206 PPTTGLTLPHSPFPPPPPGPPPKEQD--------FVRPPLPPPPQLPQSSQPPPP 252 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 35.1 bits (77), Expect = 0.076 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPP PPP P PPP PP KK PPPP Sbjct: 92 PPPSPPP--------PSPPPPSQACPPPPLPPSPPKKSYCPPPP 127 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 27.5 bits (58), Expect(2) = 0.090 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 247 PPPPPPP---PPPPPPPP 261 Score = 26.2 bits (55), Expect(2) = 0.090 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 585 KXIFXXXPPPPPPP 626 K F PPPPPPP Sbjct: 241 KATFLAPPPPPPPP 254 >At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At3g25690, At5g61090 [Arabidopsis thaliana] Length = 681 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +3 Query: 606 PPPPP--PPXXXXXXXXPXXXXGGXXXXPPPXPP-PXXKKXXPPPPP 737 PPPPP P PPP PP P K PPPPP Sbjct: 297 PPPPPLTSPQTPSPTVSTFNTKSSLRSQPPPPPPSPEHKAPAPPPPP 343 Score = 34.7 bits (76), Expect = 0.10 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P K PPPPPP Sbjct: 327 PPPPSPEHKAPAPPPPPP 344 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P + P PPPP Sbjct: 325 PPPPPPSPEHKAPAPPPP 342 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP P PPPPP PPP PPP PPPPP Sbjct: 68 PPSPSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPP-----PPPPPP 117 >At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 561 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/63 (31%), Positives = 22/63 (34%) Frame = +3 Query: 546 GXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXP 725 G G PP ++ PPPPPPP PP PPP P Sbjct: 350 GLDLLFGSDPPL---VYSPPPPPPPPPPFFQGLFSSKKGKSKKNNSNPPPPPP------P 400 Query: 726 PPP 734 PPP Sbjct: 401 PPP 403 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPP 626 PPPP F KK PPPPPPP Sbjct: 368 PPPPPPPFFQGLFSSKKGKSKKNNSNPPPPPPPPP 402 >At4g14750.1 68417.m02270 calmodulin-binding family protein contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 387 Score = 27.1 bits (57), Expect(2) = 0.12 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 564 GXXPPXKKXIFXXXPPPPPPP 626 G PP PPPPPPP Sbjct: 53 GPPPPACAITLKDSPPPPPPP 73 Score = 26.2 bits (55), Expect(2) = 0.12 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 67 PPPPPPP------PPPPP 78 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPP P G PPP PPP PPPPP Sbjct: 370 PPPPVPAPQMPSS------AGPPRPPPPAPPPGSGGPKPPPPP 406 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PP PPPP P GG P P PPP K PPPP Sbjct: 385 PPRPPPP-------APPPGSGG----PKPPPPPGPKGPRPPPP 416 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 2/61 (3%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXX--PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX 695 PPPP G PP P PPPPP P G PP Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSG 429 Query: 696 P 698 P Sbjct: 430 P 430 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P P PPPP Sbjct: 388 PPPPAPPPGSGGPKPPPP 405 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPP P P G PPP K PP P Sbjct: 388 PPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 664 GGGGXXXPPPXXPXXKKKXPPPPPP 738 G GG PPP P K P PPPP Sbjct: 396 GSGGPKPPPPPGP----KGPRPPPP 416 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPP P G PPP PPP PPPPP Sbjct: 370 PPPPVPAPQMPSS------AGPPRPPPPAPPPGSGGPKPPPPP 406 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PP PPPP P GG P P PPP K PPPP Sbjct: 385 PPRPPPP-------APPPGSGG----PKPPPPPGPKGPRPPPP 416 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 2/61 (3%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXX--PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX 695 PPPP G PP P PPPPP P G PP Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSG 429 Query: 696 P 698 P Sbjct: 430 P 430 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P P PPPP Sbjct: 388 PPPPAPPPGSGGPKPPPP 405 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPP P P G PPP K PP P Sbjct: 388 PPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 664 GGGGXXXPPPXXPXXKKKXPPPPPP 738 G GG PPP P K P PPPP Sbjct: 396 GSGGPKPPPPPGP----KGPRPPPP 416 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +3 Query: 594 FXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 F PPPPP P PPP PPP PPPPP Sbjct: 4 FGTIPPPPPLPPRLELRRQ---------RAPPPQPPPPPPPPPPPPPP 42 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 513 GGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPP 626 G PPPP PP + PPPPPPP Sbjct: 5 GTIPPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPPP 42 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP P PPPPPP Sbjct: 25 PPPQPPPPPPPPPPPPP 41 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPP P PPPPPP Sbjct: 25 PPPQPPPPPPPPPPPPPP 42 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX-PPPXXKKXXPPPPP 737 PP F PP PP P PPP PPP PPPPP Sbjct: 52 PPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPP 107 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/57 (31%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXP--PPPP 737 PP + PPP PPP P P P PP + P PPPP Sbjct: 30 PPLVFPLLPLSPPPSPPPSPSSPPRLPPPFPA--LFPPEPPLPPRFELPPPLFPPPP 84 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPP PP P PP PPP ++ PPPP Sbjct: 76 PPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEE--PPPP 116 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 6/61 (9%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPP----PPXXXXXXXXPXXXXG--GXXXXPPPXPPPXXKKXXPPPP 734 PP +F PP PP PP P PP PPP PPP Sbjct: 56 PPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPP 115 Query: 735 P 737 P Sbjct: 116 P 116 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPP--PPP 737 PP PP PPP P PP PPP + PP PPP Sbjct: 41 PPPSPPPSPSSPPRLPPPFPALFPPEPPLPP-RFELPPPLFPPPPLPRLPPPLLPPP 96 Score = 28.3 bits (60), Expect = 8.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP ++ PPPPPP Sbjct: 94 PPPEEPPREPPPPPPPP 110 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 34.3 bits (75), Expect = 0.13 Identities = 22/77 (28%), Positives = 23/77 (29%), Gaps = 5/77 (6%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPX--KKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX 695 PPPP + PP PPPP PP P PP Sbjct: 552 PPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPP 611 Query: 696 PPPXXKKXXP---PPPP 737 P P P PPPP Sbjct: 612 PSPVYSPPPPSHSPPPP 628 Score = 31.5 bits (68), Expect = 0.94 Identities = 22/75 (29%), Positives = 22/75 (29%), Gaps = 4/75 (5%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP----PPPXXXXXXXXPXXXXGGXXXXPP 689 PPPP PP PPPP PPP P PP Sbjct: 567 PPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSP------PP 620 Query: 690 PXPPPXXKKXXPPPP 734 P P PPPP Sbjct: 621 PSHSPPPPVYSPPPP 635 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/62 (30%), Positives = 20/62 (32%), Gaps = 3/62 (4%) Frame = +3 Query: 573 PPXKKXIFXXXPP---PPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXX 743 P I+ PP PPPP PPP PPP PPPP Sbjct: 543 PSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHS---PPPPPV 599 Query: 744 XS 749 S Sbjct: 600 FS 601 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPP---XPPPXXKKXXPPPP 734 PP K + PPP PP P PPP PP PPPP Sbjct: 523 PPPPK-VEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPP 578 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 33.9 bits (74), Expect = 0.18 Identities = 21/66 (31%), Positives = 23/66 (34%), Gaps = 11/66 (16%) Frame = +3 Query: 573 PPXKKXIFXXXPPPP-----PPPXXXXXXXXPXXXXGGXXXXPPP------XPPPXXKKX 719 PP ++ PPPP PPP P PPP PPP Sbjct: 55 PPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYIYN 114 Query: 720 XPPPPP 737 PPPPP Sbjct: 115 SPPPPP 120 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPP---PXPPPXXKKXXPPPPPXXXS 749 PPP PP P PP P PPP PPPPP S Sbjct: 414 PPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHS 464 Score = 31.9 bits (69), Expect = 0.71 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPP PPP PP PPPPP Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSPP----VYSPPPPP 449 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 33.9 bits (74), Expect = 0.18 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 669 GXXXXPPPXPPPXXKKXXPPPPP 737 G PPP PPP + PPPPP Sbjct: 225 GANGLPPPPPPPPHQAQPPPPPP 247 Score = 33.1 bits (72), Expect = 0.31 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P + PPPPPP Sbjct: 230 PPPPPPPPHQAQPPPPPP 247 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPPP P G PPP PP P PP Sbjct: 230 PPPPPPPPHQAQPPPPPPSG---LFPPPPPPMANNGFRPMPP 268 Score = 32.3 bits (70), Expect = 0.54 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 Query: 651 PXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 P G PPP PPP + PPPP Sbjct: 220 PQSAVGANGLPPPPPPPPHQAQPPPPPP 247 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 8/52 (15%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXX--------PPPXPPPXXKKXXPPPPP 737 PPPPPPP G PPP PPP + P PP Sbjct: 389 PPPPPPPLRSSQSVFYGLFKKGVKSNKKIHSVPAPPPPPPPRYTQFDPQTPP 440 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 4/39 (10%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPX----KKXIFXXXPPPPPPP 626 PPPP F G KK PPPPPPP Sbjct: 391 PPPPPLRSSQSVFYGLFKKGVKSNKKIHSVPAPPPPPPP 429 Score = 27.1 bits (57), Expect(2) = 0.55 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 296 PPPSPPP----PPPPPPP 309 Score = 24.2 bits (50), Expect(2) = 5.7 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXG 668 PPPPPPP P G Sbjct: 302 PPPPPPPPQPLIAATPPRKQG 322 Score = 23.8 bits (49), Expect(2) = 0.55 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 Query: 606 PPPPPPP 626 PPPPPPP Sbjct: 254 PPPPPPP 260 Score = 23.8 bits (49), Expect(3) = 0.20 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 Query: 606 PPPPPPP 626 PPPPPPP Sbjct: 300 PPPPPPP 306 Score = 23.4 bits (48), Expect(3) = 0.20 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPP 623 PP + PPPPPP Sbjct: 244 PPQQPPATPPPPPPPPP 260 Score = 23.4 bits (48), Expect(3) = 0.20 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP + PP Sbjct: 301 PPPPPPPPPQPLIAATPP 318 Score = 23.0 bits (47), Expect(2) = 5.7 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 585 KXIFXXXPPPPPPP 626 K F P PPPPP Sbjct: 291 KRTFQPPPSPPPPP 304 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP KK I P PPP P PPP P KK PP PP Sbjct: 201 PPPKKEIPPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPPIP----KKPCPPKPP 251 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +3 Query: 606 PPPP---PPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPP PPP P PP PP KK PPP P Sbjct: 335 PPPKIVIPPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVP 381 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXP--PPXXKKXXPPPPP 737 P PP PP P PPP P P K PPP P Sbjct: 245 PCPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKPPPKIEHPPPVP 290 Score = 28.3 bits (60), Expect = 8.8 Identities = 26/94 (27%), Positives = 26/94 (27%), Gaps = 3/94 (3%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXX-GGXXXXPPPXP--PPXXKKXXPPPPPXX 743 PP K F P PPP P PPP P P KK PPP P Sbjct: 157 PPFKG--FDHPFPLPPPLELPPFLKKPCPPKYSPPVEVPPPVPVYEPPPKKEIPPPVPVY 214 Query: 744 XSXXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPP 845 K PP P PP Sbjct: 215 DPPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPP 248 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGG 609 GGGGGG G G PPP G GGGGG Sbjct: 44 GGGGGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGGG 86 Score = 31.5 bits (68), Expect = 0.94 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -3 Query: 431 GGXXPPPPXXRGFFXPXFFWXGXXXGGKNPXLXTPPP 321 GG PPP +G P G GGK+P + PPP Sbjct: 61 GGGKPPPHGGKGG-GPPHHGGGGGGGGKSPPVVRPPP 96 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPP P P PPP PPP K PP P Sbjct: 49 PPPPPSPPPPSCTPSP----------PPPSPPPPKKSSCPPSP 81 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPP-PXPPPXXKKXXPPPPP 737 PP PPPP P PP P PPP PPPPP Sbjct: 52 PPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPP-----PPPPPP 91 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P P PPPP Sbjct: 50 PPPPSPPPPSCTPSPPPP 67 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/51 (27%), Positives = 15/51 (29%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXP 836 PPP P P P PPP K PP + F P Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPPNYVFTYPP 99 Score = 28.3 bits (60), Expect = 8.8 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PP PP PPPP P PPP PPP PP Sbjct: 55 PPPPSCTPSPPPPSPPPPKKSSCPPSPL---------PPPPPPPPPNYVFTYPP 99 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 33.1 bits (72), Expect = 0.31 Identities = 23/76 (30%), Positives = 24/76 (31%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPP 689 G G PPPP G + G PP P PPP P G P Sbjct: 169 GQGGPPPPY--GMRPPYPGPPPPQYGG--QQRPMMIPPPGGMMRGPPPPHGMQGPPPSRP 224 Query: 690 PXPPPXXKKXXPPPPP 737 PPP PP P Sbjct: 225 GMPPPGGAPMFAPPHP 240 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +3 Query: 564 GXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 G PP F PPPP P G P PPP PPPP Sbjct: 159 GQMPPQPP--FAGQGGPPPPYGMRPPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPP 213 Score = 25.4 bits (53), Expect(2) = 2.8 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +3 Query: 516 GXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPP--PPPPP 626 G PPP G G PP +F P PP PP Sbjct: 209 GPPPPHGMQGPPPSRPGMPPPGGAPMFAPPHPGMPPAPP 247 Score = 23.0 bits (47), Expect(2) = 2.8 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +3 Query: 321 GGXXXQXGVFPPXXXXXPKKXGGEKTP 401 GG G+ PP P + GG++ P Sbjct: 171 GGPPPPYGMRPPYPGPPPPQYGGQQRP 197 >At5g35190.1 68418.m04170 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 328 Score = 33.1 bits (72), Expect = 0.31 Identities = 21/75 (28%), Positives = 23/75 (30%), Gaps = 3/75 (4%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP---PPPXXXXXXXXPXXXXGGXXXXPPP 692 PPPP PP ++ PPPP P P P Sbjct: 232 PPPPYFSPSPKVDYKSPPPP--YVYSSPPPPPYYSPSPEVSYKSPPPPPYYSPSLEVSYK 289 Query: 693 XPPPXXKKXXPPPPP 737 PPP PPPPP Sbjct: 290 SPPPLFVYNFPPPPP 304 Score = 28.7 bits (61), Expect = 6.6 Identities = 20/74 (27%), Positives = 22/74 (29%), Gaps = 2/74 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX-- 695 P PP PP ++ PPP P P PPP Sbjct: 207 PSPPYYSPSPKVDYKSPPPP--YVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPPPPPYYS 264 Query: 696 PPPXXKKXXPPPPP 737 P P PPPPP Sbjct: 265 PSPEVSYKSPPPPP 278 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 33.1 bits (72), Expect = 0.31 Identities = 23/85 (27%), Positives = 24/85 (28%), Gaps = 2/85 (2%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPP--PPXXXSXXKXXXXGGXX 782 PPPPP P PPP PP PPP PP S Sbjct: 54 PPPPPVYSRPVAFPPPPPI--YSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPPPK 111 Query: 783 XXXXPPXXXXXFXFXXXPXPPPXXP 857 P F + P PP P Sbjct: 112 VHHPAPQAQKAFYYRQSPPPPSGQP 136 >At3g32400.1 68416.m04142 formin homology 2 domain-containing protein / FH2 domain-containing protein common family members: At2g43800, At3g25500, At5g48360, At4g15200, At3g05470, At3g07540, At5g07780, At5g07650 [Arabidopsis thaliana]; Length = 488 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPP--XXKKXXPPPPP 737 PPPPPPP P PPP PP PPPPP Sbjct: 12 PPPPPPPPLLQ----PHHSALSSSPLPPPLPPKKLLATTNTPPPPP 53 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXP-----PPXPPPXXKKXXPPPPPXXXS 749 PPPPPP P P P PPP PPPPP S Sbjct: 69 PPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPPPLHFS 120 >At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 473 Score = 26.6 bits (56), Expect(2) = 0.33 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 666 GGXXXXPPPXPPPXXKKXXPPPP 734 GG PPP PPP + PP Sbjct: 324 GGEFHPPPPPPPPPPVEYYKSPP 346 Score = 25.0 bits (52), Expect(2) = 0.33 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 594 FXXXPPPPPPP 626 F PPPPPPP Sbjct: 278 FHPSPPPPPPP 288 >At5g60850.1 68418.m07633 Dof-type zinc finger domain-containing protein similar to zinc finger protein OBP4 gi:5059396 from [Arabidopsis thaliana]; EMBL:AF155817 Length = 307 Score = 32.7 bits (71), Expect = 0.41 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 738 GGGGGGXFFFXXGXGGGG 685 GGGGGG FF G GGGG Sbjct: 14 GGGGGGGRFFGGGIGGGG 31 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 736 GGGGGXXFFXXGGGXGGG 683 GGGGG FF G G GGG Sbjct: 15 GGGGGGRFFGGGIGGGGG 32 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPP P P G P P P PPP P Sbjct: 165 PPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSP 208 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPP P P P P P P PPP Sbjct: 164 PPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPP 206 Score = 32.3 bits (70), Expect = 0.54 Identities = 22/83 (26%), Positives = 22/83 (26%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXX 788 PPPP P P G P P PPP P P P S Sbjct: 175 PPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPP-----SPSPTPGPDSPLPSPGPDSPLPL 229 Query: 789 XXPPXXXXXFXFXXXPXPPPXXP 857 PP P P P P Sbjct: 230 PGPPPSSSPTPGPDSPLPSPGPP 252 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P PPP P P G P P PPP P P Sbjct: 202 PGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSP 245 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 32.7 bits (71), Expect = 0.41 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PP +K PPPPP Sbjct: 217 PPPKPPSPPRKPPPPPPP 234 Score = 32.7 bits (71), Expect = 0.41 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +1 Query: 685 PPPXXPXXKKKXPPPPPP 738 PPP P +K PPPPPP Sbjct: 217 PPPKPPSPPRKPPPPPPP 234 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PP P +K PPPPPP Sbjct: 218 PPKPPSPPRKPPPPPPPP 235 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/44 (29%), Positives = 13/44 (29%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 P PP PP P P PPP PPP Sbjct: 13 PSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPP 56 >At3g11402.1 68416.m01388 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 708 Score = 32.7 bits (71), Expect = 0.41 Identities = 21/72 (29%), Positives = 22/72 (30%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP G K + PPPPPP P PP Sbjct: 8 PPPPPSGFKRYKKKRSKKMDNKEVPPPPPPPPPPVLPHIRSRKKMDIKEVHLPLPRHYPP 67 Query: 702 PXXKKXXPPPPP 737 P PPPPP Sbjct: 68 PPPP--LPPPPP 77 Score = 28.7 bits (61), Expect = 6.6 Identities = 22/74 (29%), Positives = 22/74 (29%), Gaps = 3/74 (4%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXP- 698 PPPP G KK PPPPPPP P P Sbjct: 7 PPPPPPSGFKRY---KKKRSKKMDNKEVPPPPPPPPPPVLPHIRSRKKMDIKEVHLPLPR 63 Query: 699 --PPXXKKXXPPPP 734 PP PPPP Sbjct: 64 HYPPPPPPLPPPPP 77 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 32.7 bits (71), Expect = 0.41 Identities = 33/124 (26%), Positives = 34/124 (27%), Gaps = 11/124 (8%) Frame = +3 Query: 510 GGGXP-----PPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPP------XXXXXXXXPX 656 GGG P PPP GGG G PP + P PPP P Sbjct: 98 GGGEPVIPGAPPPNRGGGETVIPGAPPPIRGGGGEPAIPGAPPPKRGGGGEPVIPGAPPP 157 Query: 657 XXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXXXXPPXXXXXFXFXXXP 836 GG P PPP P P K G PP P Sbjct: 158 KRGGGGEPVIPGAPPPKRGGGGEPVIP-GAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIP 216 Query: 837 XPPP 848 PP Sbjct: 217 GAPP 220 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 516 GXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPP 626 G PPP GGG G PP + P PPP Sbjct: 185 GAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPP 221 >At2g39250.1 68415.m04820 AP2 domain-containing transcription factor, putative AP2_ARATH Floral homeotic protein APETALA2.(SP:P47927){Arabidopsis thaliana} Length = 222 Score = 26.2 bits (55), Expect(2) = 0.45 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 55 PPPPPPP------PPPPP 66 Score = 25.0 bits (52), Expect(2) = 0.45 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 582 KKXIFXXXPPPPPPP 626 K+ + PPPPPPP Sbjct: 48 KRNVEILPPPPPPPP 62 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 32.3 bits (70), Expect = 0.54 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 4/59 (6%) Frame = +3 Query: 573 PPXKKXIFXXXPP--PP--PPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP I PP PP PPP P PPP P P + PPPPP Sbjct: 25 PPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQ--PPPPP 81 Score = 31.9 bits (69), Expect = 0.71 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +3 Query: 573 PPXKKXIFXXXPPPP--PPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP PPPP PP P P P PP PPPPP Sbjct: 33 PPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPP 89 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 32.3 bits (70), Expect = 0.54 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSX 752 PP K PPPPP P P P PPP K PPP P + Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPP--------PKPQPPPPPKIARPPPAPPKGAA 305 Query: 753 XK 758 K Sbjct: 306 PK 307 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP PPPPPP Sbjct: 265 PPPPPAAAPPPQPPPPPP 282 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP PPPPPP Sbjct: 266 PPPPAAAPPPQPPPPPPP 283 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 32.3 bits (70), Expect = 0.54 Identities = 21/75 (28%), Positives = 24/75 (32%), Gaps = 3/75 (4%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP---PPPXXXXXXXXPXXXXGGXXXXPPP 692 PPPP G P ++ PPPP P P P PPP Sbjct: 212 PPPPYYSPSPKV--GYKSPPAPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPP--PPP 267 Query: 693 XPPPXXKKXXPPPPP 737 P + PPPP Sbjct: 268 YSPSPKVEFKSPPPP 282 Score = 29.9 bits (64), Expect = 2.9 Identities = 24/79 (30%), Positives = 24/79 (30%), Gaps = 3/79 (3%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPP--PPXXXXXXXXPXXXXGGXXXXPPPX 695 PPPP PP F PPPPP P P PPP Sbjct: 186 PPPPYYSPSPKVEYKSPPPPYVYSF---PPPPPYYSPSPKVGYKSPPAPYVYSSPPPPPY 242 Query: 696 PPPXXK-KXXPPPPPXXXS 749 P K PPPP S Sbjct: 243 YSPSPKVNYKSPPPPYVYS 261 Score = 29.5 bits (63), Expect = 3.8 Identities = 20/74 (27%), Positives = 22/74 (29%), Gaps = 3/74 (4%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP---PPPXXXXXXXXPXXXXGGXXXXPPP 692 PPPP PP ++ PPPP P P P P Sbjct: 350 PPPPYYSPSPTVNYKSPPPP--YVYNSPPPPPYYSPFPKVEYKSPPPPYIYNSPPPPPYY 407 Query: 693 XPPPXXKKXXPPPP 734 P P PPPP Sbjct: 408 SPSPKITYKSPPPP 421 Score = 29.1 bits (62), Expect = 5.0 Identities = 21/77 (27%), Positives = 23/77 (29%), Gaps = 1/77 (1%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP ++ PPPP P P PP Sbjct: 238 PPPPYYSPSPKVNYKSPPPP--YVYSSPPPPPYSPSPKVEFKSPPPPYIYNSPPPPSYYS 295 Query: 702 PXXK-KXXPPPPPXXXS 749 P K PPPP S Sbjct: 296 PSPKIDYKSPPPPYVYS 312 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 32.3 bits (70), Expect = 0.54 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P + PPPPPP Sbjct: 267 PPPPPPGSWQPSPPPPPP 284 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PP + PPPPP Sbjct: 267 PPPPPPGSWQPSPPPPPP 284 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 32.3 bits (70), Expect = 0.54 Identities = 25/84 (29%), Positives = 28/84 (33%), Gaps = 13/84 (15%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKX-----IFXXXPPP---PPPPXXXXXXXXPXXXXGGXX 677 PPPP + PP K ++ PPP PPPP P Sbjct: 61 PPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPY 120 Query: 678 XX---PPPX--PPPXXKKXXPPPP 734 PPP PPP PPPP Sbjct: 121 YYHSPPPPVKSPPPPYYYHSPPPP 144 Score = 30.7 bits (66), Expect = 1.6 Identities = 25/84 (29%), Positives = 27/84 (32%), Gaps = 13/84 (15%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKX-----IFXXXPPP---PPPPXXXXXXXXPXXXXGGXX 677 PPPP + PP K + PPP PPPP P Sbjct: 93 PPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPY 152 Query: 678 XX---PPPX--PPPXXKKXXPPPP 734 PPP PPP PPPP Sbjct: 153 YYHSPPPPVKSPPPPYYYHSPPPP 176 Score = 30.7 bits (66), Expect = 1.6 Identities = 25/84 (29%), Positives = 27/84 (32%), Gaps = 13/84 (15%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKX-----IFXXXPPP---PPPPXXXXXXXXPXXXXGGXX 677 PPPP + PP K + PPP PPPP P Sbjct: 109 PPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPY 168 Query: 678 XX---PPPX--PPPXXKKXXPPPP 734 PPP PPP PPPP Sbjct: 169 YYHSPPPPVKSPPPPYLYSSPPPP 192 Score = 29.9 bits (64), Expect = 2.9 Identities = 25/84 (29%), Positives = 26/84 (30%), Gaps = 13/84 (15%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKX-----IFXXXPPP---PPPPXXXXXXXXPXXXXGGXX 677 PPPP PP K + PPP PPPP P Sbjct: 77 PPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPY 136 Query: 678 XX---PPPX--PPPXXKKXXPPPP 734 PPP PPP PPPP Sbjct: 137 YYHSPPPPVKSPPPPYYYHSPPPP 160 Score = 29.9 bits (64), Expect = 2.9 Identities = 25/85 (29%), Positives = 27/85 (31%), Gaps = 13/85 (15%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKX-----IFXXXPPP---PPPPXXXXXXXXPXXXXGGXX 677 PPPP + PP K + PPP PPPP P Sbjct: 125 PPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPY 184 Query: 678 XX---PPPX--PPPXXKKXXPPPPP 737 PPP PPP PPPP Sbjct: 185 LYSSPPPPVKSPPPPVYIYASPPPP 209 Score = 29.1 bits (62), Expect = 5.0 Identities = 24/79 (30%), Positives = 26/79 (32%), Gaps = 8/79 (10%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP---PPPPXXXXXXXXPXXXXGGXXXX--- 683 PPPP PP + + PPP PPPP P Sbjct: 36 PPPPYEYKSPPPPVKSPPPPYE--YKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSP 93 Query: 684 PPPX--PPPXXKKXXPPPP 734 PPP PPP PPPP Sbjct: 94 PPPVKSPPPPYYYHSPPPP 112 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPP PP P P P PPP PPPPP Sbjct: 147 PPPESPPPESLPPPSPESPS-----PPSPEPPPPSSLEPPPPPP 185 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 615 PPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPP P P PPP + PPPP Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 32.3 bits (70), Expect = 0.54 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKK---XXPPPPP 737 PPPP PP P PP PPP KK PPPPP Sbjct: 59 PPPPSPP--------PPSPPPPACPPPPALPPPPPKKVSSYCPPPPP 97 >At1g21310.1 68414.m02662 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 431 Score = 32.3 bits (70), Expect = 0.54 Identities = 26/90 (28%), Positives = 30/90 (33%), Gaps = 18/90 (20%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP------------PPPPXXXXXXXXPXXXX 665 PPP + PP K ++ PPP PPPP P Sbjct: 322 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 381 Query: 666 GGXXXXPPP---XPPPXXKK---XXPPPPP 737 PPP PPP +K PPPPP Sbjct: 382 --KHYSPPPVYHSPPPPKEKYVYKSPPPPP 409 Score = 29.5 bits (63), Expect = 3.8 Identities = 23/87 (26%), Positives = 26/87 (29%), Gaps = 15/87 (17%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP------------PPPPXXXXXXXXPXXXX 665 PPP + PP K ++ PPP PPPP P Sbjct: 70 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 129 Query: 666 GGXXXXPPPXPPPXXKK---XXPPPPP 737 P PP KK PPPP Sbjct: 130 KHYSPPPVYHSPPPPKKHYVYKSPPPP 156 Score = 29.5 bits (63), Expect = 3.8 Identities = 23/87 (26%), Positives = 26/87 (29%), Gaps = 15/87 (17%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP------------PPPPXXXXXXXXPXXXX 665 PPP + PP K ++ PPP PPPP P Sbjct: 154 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 213 Query: 666 GGXXXXPPPXPPPXXKK---XXPPPPP 737 P PP KK PPPP Sbjct: 214 KHYSPPPVYHSPPPPKKHYVYKSPPPP 240 Score = 29.5 bits (63), Expect = 3.8 Identities = 23/87 (26%), Positives = 26/87 (29%), Gaps = 15/87 (17%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP------------PPPPXXXXXXXXPXXXX 665 PPP + PP K ++ PPP PPPP P Sbjct: 238 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 297 Query: 666 GGXXXXPPPXPPPXXKK---XXPPPPP 737 P PP KK PPPP Sbjct: 298 KHYSPPPVYHSPPPPKKHYVYKSPPPP 324 Score = 29.1 bits (62), Expect = 5.0 Identities = 22/74 (29%), Positives = 22/74 (29%), Gaps = 4/74 (5%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP----PPPXXXXXXXXPXXXXGGXXXXPP 689 PPPP PP KK PPPP PP P Sbjct: 97 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY------VY 150 Query: 690 PXPPPXXKKXXPPP 731 PPP K PPP Sbjct: 151 KSPPPPVKHYSPPP 164 Score = 29.1 bits (62), Expect = 5.0 Identities = 22/74 (29%), Positives = 22/74 (29%), Gaps = 4/74 (5%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP----PPPXXXXXXXXPXXXXGGXXXXPP 689 PPPP PP KK PPPP PP P Sbjct: 181 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY------VY 234 Query: 690 PXPPPXXKKXXPPP 731 PPP K PPP Sbjct: 235 KSPPPPVKHYSPPP 248 Score = 29.1 bits (62), Expect = 5.0 Identities = 22/74 (29%), Positives = 22/74 (29%), Gaps = 4/74 (5%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP----PPPXXXXXXXXPXXXXGGXXXXPP 689 PPPP PP KK PPPP PP P Sbjct: 265 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY------VY 318 Query: 690 PXPPPXXKKXXPPP 731 PPP K PPP Sbjct: 319 KSPPPPVKHYSPPP 332 >At1g12810.1 68414.m01488 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 129 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +3 Query: 513 GGXPPP---PXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPP 626 GG PPP P GG F G P + PPPPPPP Sbjct: 51 GGYPPPSSRPYEGGYQGYFAGGGYPHQHH----GPPPPPPP 87 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 31.9 bits (69), Expect = 0.71 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPPPPP P G PPP PP Sbjct: 24 PPPPPPPMRRSAPSPPPM--SGRVPPPPPPPP 53 Score = 31.9 bits (69), Expect = 0.71 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 687 PPXPPPXXKKXXPPPPP 737 PP PPP ++ PPPPP Sbjct: 150 PPPPPPMPRRSPPPPPP 166 Score = 31.5 bits (68), Expect = 0.94 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPP 704 PPPPPP P G PPP PPP Sbjct: 24 PPPPPPPMRRSAPSPPPMSG--RVPPPPPPPP 53 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPPXXXXXXXKXXR 772 PPP P + PPPPPP K R Sbjct: 150 PPPPPPMPRRSPPPPPPRFDAFDHKGAR 177 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 666 GGXXXXPPPXPPPXXKKXXPPPPP 737 G P P PPP + PPPPP Sbjct: 142 GADALVPLPPPPPPMPRRSPPPPP 165 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 P PP P PPPPPP Sbjct: 638 PSPPPPSMSGGAPPPPPP 655 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 685 PPPXXPXXKKKXPPPPPPXXXL 750 PPP P PPPPPP L Sbjct: 698 PPPTLPSMSGGAPPPPPPLPML 719 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +3 Query: 669 GXXXXPPPXPPPXXKKXXPPPP 734 G PPP PPP + PPP Sbjct: 19 GRVPLPPPPPPPMRRSAPSPPP 40 Score = 28.7 bits (61), Expect = 6.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPP 736 PPPP P ++ P PPP Sbjct: 24 PPPPPPPMRRSAPSPPP 40 Score = 28.3 bits (60), Expect = 8.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP PPPPPP Sbjct: 640 PPPPSMSGGAPPPPPPPP 657 >At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ZF-HD homeobox protein-related predicted proteins, Arabidopsis thaliana Length = 334 Score = 26.6 bits (56), Expect(2) = 0.74 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPPXXXS 749 PPP PPP PPP S Sbjct: 137 PPPPPPPPRSPNSASPPPISSS 158 Score = 24.6 bits (51), Expect(2) = 2.7 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPPXXXS 749 PPP PPP + PP S Sbjct: 136 PPPPPPPPPRSPNSASPPPISS 157 Score = 23.8 bits (49), Expect(2) = 2.7 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 Query: 606 PPPPPPP 626 PPPPPPP Sbjct: 135 PPPPPPP 141 Score = 23.8 bits (49), Expect(2) = 0.74 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 Query: 606 PPPPPPP 626 PPPPPPP Sbjct: 136 PPPPPPP 142 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 31.5 bits (68), Expect = 0.94 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXS 749 PPPPP P PP P PPPPP S Sbjct: 31 PPPPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTS 77 Score = 31.5 bits (68), Expect = 0.94 Identities = 24/79 (30%), Positives = 24/79 (30%), Gaps = 7/79 (8%) Frame = +3 Query: 522 PPPPXX---GGGXXXFXGXXPPXKKXIFXXXPP----PPPPPXXXXXXXXPXXXXGGXXX 680 PPPP G P F PP PPPPP P Sbjct: 32 PPPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSP---PPVATTPPAL 88 Query: 681 XPPPXPPPXXKKXXPPPPP 737 P P PPP PPPP Sbjct: 89 PPKPLPPPLSPPQTTPPPP 107 Score = 31.5 bits (68), Expect = 0.94 Identities = 24/88 (27%), Positives = 24/88 (27%), Gaps = 4/88 (4%) Frame = +3 Query: 606 PPPP----PPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXG 773 PPPP PPP P PP PP PPPPP Sbjct: 70 PPPPQSTSPPPVATTPPALPPKPLP-PPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPA 128 Query: 774 GXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PP P PPP P Sbjct: 129 ---ITPPPPLATTPPALPPKPLPPPLSP 153 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = +3 Query: 573 PPXKKXIFXXXPP---PPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP I PP PP P P P P PPP PPPP Sbjct: 104 PPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPP 161 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPP 731 PP I P PPPP P PP PP + PPP Sbjct: 31 PPPPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPPPP---QSTSPPP 80 Score = 28.3 bits (60), Expect = 8.8 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +3 Query: 606 PPP---PPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPP PPPP P PPP PP + PPPPP Sbjct: 125 PPPAITPPPPLATTPPALP------PKPLPPPLSPP---QTTPPPPP 162 >At3g54580.1 68416.m06039 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 951 Score = 31.5 bits (68), Expect = 0.94 Identities = 19/72 (26%), Positives = 22/72 (30%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PPP Sbjct: 646 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYS 703 Query: 702 PXXKKXXPPPPP 737 P K PPP Sbjct: 704 PSPKVVYKSPPP 715 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/76 (25%), Positives = 23/76 (30%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 546 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYHSP 603 Query: 702 PXXKKXXPPPPPXXXS 749 + PPPP S Sbjct: 604 SPKVQYKSPPPPYVYS 619 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP ++ PPP P P PP P Sbjct: 80 PPPPTYSPSPKVEYKSPPPP--YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSP 137 Query: 702 PXXKKXXPPPPPXXXS 749 + PPPP S Sbjct: 138 SPKVEYKSPPPPYVYS 153 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP ++ PPP P P PP P Sbjct: 105 PPPPTYSPSPKVEYKSPPPP--YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSP 162 Query: 702 PXXKKXXPPPPPXXXS 749 + PPPP S Sbjct: 163 SPKVEYKSPPPPYVYS 178 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP ++ PPP P P PP P Sbjct: 130 PPPPTYSPSPKVEYKSPPPP--YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSP 187 Query: 702 PXXKKXXPPPPPXXXS 749 + PPPP S Sbjct: 188 SPKVEYKSPPPPYVYS 203 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP ++ PPP P P PP P Sbjct: 305 PPPPYYSPSPKVDYKSPPPP--YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSP 362 Query: 702 PXXKKXXPPPPPXXXS 749 + PPPP S Sbjct: 363 SPKVEYKSPPPPYVYS 378 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP ++ PPP P P PP P Sbjct: 330 PPPPTYSPSPKVEYKSPPPP--YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSP 387 Query: 702 PXXKKXXPPPPPXXXS 749 + PPPP S Sbjct: 388 SPKVEYKSPPPPYVYS 403 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP ++ PPP P P PP P Sbjct: 355 PPPPTYSPSPKVEYKSPPPP--YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSP 412 Query: 702 PXXKKXXPPPPPXXXS 749 + PPPP S Sbjct: 413 SPKVEYKSPPPPYVYS 428 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 571 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYHSPSPKVQYKSPPPPYVYSSPPPPYYSP 628 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 629 SPKVYYKSPPPPYVYS 644 Score = 29.1 bits (62), Expect = 5.0 Identities = 21/78 (26%), Positives = 24/78 (30%), Gaps = 2/78 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP--PPPPXXXXXXXXPXXXXGGXXXXPPPX 695 PPPP + PP ++ PPP P P P PPP Sbjct: 480 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVYYKSPPPPYVYSS---PPPPY 534 Query: 696 PPPXXKKXXPPPPPXXXS 749 P K PPP S Sbjct: 535 YSPSPKVYYKSPPPPYYS 552 Score = 28.7 bits (61), Expect = 6.6 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP ++ PPP P P PP P Sbjct: 155 PPPPTYSPSPKVEYKSPPPP--YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSP 212 Query: 702 PXXKKXXPPPPPXXXS 749 + PPPP S Sbjct: 213 SPKVEYKSPPPPYVYS 228 Score = 28.7 bits (61), Expect = 6.6 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP ++ PPP P P PP P Sbjct: 205 PPPPYYSPSPKVEYKSPPPP--YVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSP 262 Query: 702 PXXKKXXPPPPPXXXS 749 + PPPP S Sbjct: 263 SPKVEYKSPPPPYVYS 278 Score = 28.7 bits (61), Expect = 6.6 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP ++ PPP P P PP P Sbjct: 280 PPPPTYSPSPKVDYKSPPPP--YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSP 337 Query: 702 PXXKKXXPPPPPXXXS 749 + PPPP S Sbjct: 338 SPKVEYKSPPPPYVYS 353 Score = 28.7 bits (61), Expect = 6.6 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP ++ PPP P P PP P Sbjct: 380 PPPPTYSPSPKVEYKSPPPP--YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSP 437 Query: 702 PXXKKXXPPPPPXXXS 749 + PPPP S Sbjct: 438 SPKVEYKSPPPPYVYS 453 Score = 28.3 bits (60), Expect = 8.8 Identities = 18/76 (23%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPP + PP ++ PPP P P PP P Sbjct: 56 PPPTYSPAPEVEYKSPPPPY---VYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSP 112 Query: 702 PXXKKXXPPPPPXXXS 749 + PPPP S Sbjct: 113 SPKVEYKSPPPPYVYS 128 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 31.5 bits (68), Expect = 0.94 Identities = 23/89 (25%), Positives = 24/89 (26%), Gaps = 4/89 (4%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP-P---PPPXXXXXXXXPXXXXGGXXXXPP 689 PPPP PP PPP P PPP PP Sbjct: 68 PPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPP 127 Query: 690 PXPPPXXKKXXPPPPPXXXSXXKXXXXGG 776 P P + PPPP GG Sbjct: 128 PPPADEDESPPAPPPPEQLPPPASSPQGG 156 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPP---XPPPXXKKXXPPPPP 737 PPP PP P PPP PPP PPPPP Sbjct: 37 PPPSPPADSSPPPALPSLPPA--VFSPPPTVSSPPPPPLDSSPPPPP 81 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 4/46 (8%) Frame = +3 Query: 606 PPP----PPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPP 731 PPP PPPP P PPP PP PPP Sbjct: 61 PPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPP 106 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 12/67 (17%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPP---XXXXXXXXPXXXXGGXXXXPPP---------XPPPXXKK 716 PP PPPP PP P GG PPP PPP Sbjct: 55 PPPPSTPTTACPPPPSPPSSGGGSSYYYPPPSQSGGGSKYPPPYGGGGQGYYYPPPYSGN 114 Query: 717 XXPPPPP 737 PPPP Sbjct: 115 YPTPPPP 121 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +3 Query: 510 GGGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPP 620 GG PPP GGG + PP + PPP P Sbjct: 90 GGSKYPPPYGGGGQGYY---YPPPYSGNYPTPPPPNP 123 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPPPP Sbjct: 103 PPPPQPLNLFSPPPPPPP 120 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP PPPPPP Sbjct: 102 PPPPPQPLNLFSPPPPPP 119 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/72 (29%), Positives = 23/72 (31%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP F PP K + PPPPP P G PPP P Sbjct: 42 PPPPQVFVPEPLFSEPPPPPKAPVNVSLS-PPPPPRSPSTSTPPRL---GNRNPPPPASP 97 Query: 702 PXXKKXXPPPPP 737 + P P Sbjct: 98 SGQEPTTPTMTP 109 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPPP P PP PPP PPPP Sbjct: 64 PPPPPPTSPPPPSPP----------PPSPPPPSPPPPSPPPP 95 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPP P PPP PPP PPPP Sbjct: 64 PPPPPPTSPPPPSP----------PPPSPPPPSPPPPSPPPP 95 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PP PPP Sbjct: 72 PPPPSPPPPSPPPPSPPP 89 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PP PPP Sbjct: 77 PPPPSPPPPSPPPPSPPP 94 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXP--PPXPPPXXKKXXPPPPP 737 P PPP P P P PP PP K PPP P Sbjct: 40 PKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEP 85 Score = 30.7 bits (66), Expect = 1.6 Identities = 22/94 (23%), Positives = 24/94 (25%) Frame = +3 Query: 576 PXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXX 755 P K + P P P P P PPP P P K PP P Sbjct: 18 PSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQP--KPVPPPACPPTPPKP 75 Query: 756 KXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 + PP P PP P Sbjct: 76 QPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTP 109 >At3g55950.1 68416.m06217 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to cytokinin-regulated kinase 1 [Nicotiana tabacum] gi|10998537|gb|AAG25966 Length = 814 Score = 25.0 bits (52), Expect(2) = 1.5 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 594 FXXXPPPPPPP 626 F PPPPPPP Sbjct: 368 FPLPPPPPPPP 378 Score = 24.2 bits (50), Expect(2) = 1.5 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +3 Query: 684 PPPXPPPXXKKXXPP 728 PPP PPP PP Sbjct: 373 PPPPPPPSPSTSSPP 387 >At3g04610.1 68416.m00493 KH domain-containing protein similar putative nucleic acid binding protein GB:CAB39665 [Arabidopsis thaliana]; Pfam HMM hit: KH domain family of RNA binding proteins Length = 577 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/66 (28%), Positives = 19/66 (28%), Gaps = 2/66 (3%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPP--XPPPXXKKXXPPPPPXXXSXXKXXXXGGXX 782 PPP P GG PPP PPP PPP K G Sbjct: 377 PPPHQSWGPPQGHAPSVGGGGYGHNPPPYMQPPPRHDSYYPPPEMRQPPMEKQPHQGISA 436 Query: 783 XXXXPP 800 PP Sbjct: 437 YGREPP 442 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 30.3 bits (65), Expect = 2.2 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 P P PPP + PPPPP Sbjct: 88 PQPPPPPPIENLPPPPPP 105 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 P PP P + PPPPPP Sbjct: 88 PQPPPPPPIENLPPPPPP 105 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 30.3 bits (65), Expect = 2.2 Identities = 25/82 (30%), Positives = 26/82 (31%), Gaps = 11/82 (13%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPX--KKXIFXXXPPPPP--------PPXXXXXXXXPXXXXGG 671 PPPP G G G PP + PPPP PP P G Sbjct: 167 PPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGM 226 Query: 672 XXXXPP-PXPPPXXKKXXPPPP 734 PP P PP PP P Sbjct: 227 QGPPPPRPGMPPAPGGFAPPRP 248 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 30.3 bits (65), Expect = 2.2 Identities = 25/82 (30%), Positives = 26/82 (31%), Gaps = 11/82 (13%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPX--KKXIFXXXPPPPP--------PPXXXXXXXXPXXXXGG 671 PPPP G G G PP + PPPP PP P G Sbjct: 167 PPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGM 226 Query: 672 XXXXPP-PXPPPXXKKXXPPPP 734 PP P PP PP P Sbjct: 227 QGPPPPRPGMPPAPGGFAPPRP 248 >At4g08410.1 68417.m01390 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 707 Score = 30.3 bits (65), Expect = 2.2 Identities = 24/81 (29%), Positives = 26/81 (32%), Gaps = 3/81 (3%) Frame = +3 Query: 516 GXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP--PPPPXXXXXXXXPXXXXGGXXXXPP 689 G PPPP PP ++ PPP P P P G PP Sbjct: 283 GSPPPPYYSPSPKVDYKSPPPP--YVYSSPPPPYYSPSPKVNYKSPPPPYVYGSP---PP 337 Query: 690 PXPPPXXK-KXXPPPPPXXXS 749 P P K PPPP S Sbjct: 338 PYYSPSPKVDYKSPPPPYVYS 358 Score = 29.1 bits (62), Expect = 5.0 Identities = 20/78 (25%), Positives = 22/78 (28%) Frame = +3 Query: 516 GXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX 695 G PPPP PP ++ PPP P P PP Sbjct: 333 GSPPPPYYSPSPKVDYKSPPPP--YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSTPPPYY 390 Query: 696 PPPXXKKXXPPPPPXXXS 749 P PPPP S Sbjct: 391 SPSPKVDYKSPPPPYVYS 408 Score = 28.3 bits (60), Expect = 8.8 Identities = 23/79 (29%), Positives = 25/79 (31%), Gaps = 3/79 (3%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP--PPPPXXXXXXXXPXXXXGGXXXXPPPX 695 PPPP PP ++ PPP P P P G PPP Sbjct: 235 PPPPYYSPSPKVDYKSPPPP--YVYSSPPPPYYSPSPKVNYKSPPPPYVYGSP---PPPY 289 Query: 696 PPPXXK-KXXPPPPPXXXS 749 P K PPPP S Sbjct: 290 YSPSPKVDYKSPPPPYVYS 308 Score = 28.3 bits (60), Expect = 8.8 Identities = 19/76 (25%), Positives = 21/76 (27%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP ++ PPP P P PP P Sbjct: 460 PPPPYYSPSPKV--DYKPPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSFPPPPYYSP 517 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 518 SPKVDYKSPPPPYVYS 533 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -1 Query: 736 GGGGGXXFFXXGGGXGGGXXXXPPXXXXG 650 GGGGG + GGG GGG P G Sbjct: 576 GGGGGGSDYYGGGGYGGGGYGGAPSGGYG 604 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -1 Query: 736 GGGGGXXFFXXGGGXGGGXXXXPPXXXXG 650 GGGGG + GGG GGG P G Sbjct: 576 GGGGGGSDYYGGGGYGGGGYGGAPSGGYG 604 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPPPPPP P PPP PPP P P Sbjct: 9 PPPPPPPPPRLLVLPP--------LPPPPPPPPPQLPFGPKLP 43 Score = 28.7 bits (61), Expect = 6.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPP 626 PP + + PPPPPPP Sbjct: 15 PPPRLLVLPPLPPPPPPP 32 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/60 (30%), Positives = 19/60 (31%), Gaps = 1/60 (1%) Frame = +3 Query: 558 FXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP-PXXKKXXPPPP 734 F PP F P PPPPP PPP PP P + P P Sbjct: 7 FTPPPPPPPPPSFRSIPRPPPPPSFRSIPPRRHFFKKKSKSLPPPPPPLPPARPFGPILP 66 Score = 30.3 bits (65), Expect = 2.2 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP + PPPP Sbjct: 11 PPPPPPPSFRSIPRPPPP 28 Score = 30.3 bits (65), Expect = 2.2 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P + PPPPP Sbjct: 12 PPPPPPSFRSIPRPPPPP 29 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP + P PPP Sbjct: 10 PPPPPPPPSFRSIPRPPP 27 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P + P PPPP Sbjct: 11 PPPPPPPSFRSIPRPPPP 28 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = +3 Query: 591 IFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXK-KXXPPPPP 737 I PPPPPPP PP K K PPPPP Sbjct: 4 ILSFTPPPPPPPPPSFRSIPRPPPPPSFRSIPPRRHFFKKKSKSLPPPPP 53 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 594 FXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPP 704 F PPPPPPP P PPP PPP Sbjct: 40 FLPHPPPPPPP-------PPPPLYFSYFSLPPPPPPP 69 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/73 (27%), Positives = 23/73 (31%), Gaps = 2/73 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX-- 695 PPPP PP ++ PPP P P PPP Sbjct: 693 PPPPYYSPAPKPTYKSPPPP--YVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYS 750 Query: 696 PPPXXKKXXPPPP 734 P P + PPPP Sbjct: 751 PSPKVEYKSPPPP 763 Score = 29.9 bits (64), Expect = 2.9 Identities = 22/76 (28%), Positives = 25/76 (32%), Gaps = 5/76 (6%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP---PPPXXXXXXXXPXXXXGGXXXXPPP 692 PPPP PP ++ PPPP P P P PPP Sbjct: 718 PPPPYYSPSPKPTYKSPPPP--YVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSP---PPP 772 Query: 693 X--PPPXXKKXXPPPP 734 P P + PPPP Sbjct: 773 YYSPSPKVEYKSPPPP 788 Score = 29.9 bits (64), Expect = 2.9 Identities = 20/73 (27%), Positives = 23/73 (31%), Gaps = 2/73 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPX-- 695 PPPP PP ++ PPP P P PPP Sbjct: 744 PPPPYYSPSPKVEYKSPPPP--YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYS 801 Query: 696 PPPXXKKXXPPPP 734 P P + PPPP Sbjct: 802 PSPKVEYKSPPPP 814 Score = 28.7 bits (61), Expect = 6.6 Identities = 22/77 (28%), Positives = 25/77 (32%), Gaps = 6/77 (7%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP---PPPXXXXXXXXPXXXXGGXXXXPPP 692 PPPP PP ++ PPPP P P P PPP Sbjct: 769 PPPPYYSPSPKVEYKSPPP--PYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSS---PPPP 823 Query: 693 ---XPPPXXKKXXPPPP 734 P P + PPPP Sbjct: 824 TYYSPSPKVEYKSPPPP 840 Score = 28.3 bits (60), Expect = 8.8 Identities = 20/76 (26%), Positives = 21/76 (27%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP I+ PPP P P PP P Sbjct: 191 PPPPYYSPSPKPTYKSPPPP--YIYSSPPPPYYSPSPKPVYKSPPPPYVYSSPPPPYYSP 248 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 249 SPKPAYKSPPPPYVYS 264 Score = 28.3 bits (60), Expect = 8.8 Identities = 21/74 (28%), Positives = 23/74 (31%), Gaps = 3/74 (4%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPP---P 692 PPPP PP ++ PPP P P PP P Sbjct: 266 PPPPYYSPSPKPIYKSPPPP--YVYNSPPPPYYSPSPKPAYKSPPPPYVYSFPPPPYYSP 323 Query: 693 XPPPXXKKXXPPPP 734 P P K PPPP Sbjct: 324 SPKPVYKS--PPPP 335 Score = 28.3 bits (60), Expect = 8.8 Identities = 19/76 (25%), Positives = 21/76 (27%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP ++ PPP P P PP P Sbjct: 316 PPPPYYSPSPKPVYKSPPPP--YVYNSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSP 373 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 374 SPKPTYKSPPPPYVYS 389 Score = 28.3 bits (60), Expect = 8.8 Identities = 19/76 (25%), Positives = 21/76 (27%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP ++ PPP P P PP P Sbjct: 593 PPPPYYSPAPKPVYKSPPPP--YVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSP 650 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 651 TPKPTYKSPPPPYVYS 666 >At4g03390.1 68417.m00461 leucine-rich repeat transmembrane protein kinase, putative similar to Z. mays leucine-rich repeat transmembrane protein kinase LRRTPK 1, GenBank accession number AF023164 Length = 776 Score = 27.1 bits (57), Expect(2) = 2.5 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPPPP Sbjct: 427 PPPPPPP----PPPPPPP 440 Score = 21.4 bits (43), Expect(2) = 2.5 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 Query: 594 FXXXPPPPPPP 626 F PPPPPP Sbjct: 422 FSMLMPPPPPP 432 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PP PPP PPPPP Sbjct: 262 PPNRPPPPSSPPPPPPPP 279 Score = 25.0 bits (52), Expect(2) = 2.6 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPP 626 PP + PPPPPPP Sbjct: 262 PPNRPPPPSSPPPPPPPP 279 Score = 23.4 bits (48), Expect(2) = 2.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPPXXXS 749 PPP PPP PP PP S Sbjct: 272 PPPPPPP------PPTPPTSRS 287 >At2g23770.1 68415.m02839 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein contains Pfam domains, PF00069: Protein kinase domain and PF01476: LysM domain Length = 612 Score = 25.0 bits (52), Expect(2) = 2.6 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PP P Sbjct: 245 PPPPPPPPQSVSPPPLSP 262 Score = 23.4 bits (48), Expect(2) = 2.6 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPP 623 PP PPPPPP Sbjct: 236 PPANTNSLIPPPPPPPP 252 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 24.6 bits (51), Expect(2) = 2.7 Identities = 11/22 (50%), Positives = 11/22 (50%), Gaps = 4/22 (18%) Frame = +3 Query: 684 PPPXPP----PXXKKXXPPPPP 737 PPP PP P PPPPP Sbjct: 223 PPPPPPSQPLPRPLLLPPPPPP 244 Score = 23.8 bits (49), Expect(2) = 2.7 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 Query: 606 PPPPPPP 626 PPPPPPP Sbjct: 222 PPPPPPP 228 >At4g23890.1 68417.m03436 expressed protein hypothetical protein, Synechocystis sp., PIR:S76577 Length = 250 Score = 26.2 bits (55), Expect(2) = 2.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 558 FXGXXPPXKKXIFXXXPPPPPPP 626 F G K I PPPPPPP Sbjct: 122 FPGGEKGLKTFIEKNPPPPPPPP 144 Score = 22.2 bits (45), Expect(2) = 2.8 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 684 PPPXPPPXXKK 716 PPP PPP K+ Sbjct: 138 PPPPPPPPAKQ 148 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 4/48 (8%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP----PXXKKXXPPPPP 737 PP PPP P PPP PP P PPPP Sbjct: 44 PPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPP 91 Score = 29.5 bits (63), Expect = 3.8 Identities = 20/76 (26%), Positives = 21/76 (27%), Gaps = 4/76 (5%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP----PPPXXXXXXXXPXXXXGGXXXXPP 689 PPP PP P PP PPP P P Sbjct: 48 PPPVVSSSPPPPVVSSPPPSSSP----PPSPPVITSPPPTVASSPPPPVVIASPPPSTPA 103 Query: 690 PXPPPXXKKXXPPPPP 737 PP + PPPPP Sbjct: 104 TTPPAPPQTVSPPPPP 119 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/43 (30%), Positives = 13/43 (30%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPP P P P P P P PPPP Sbjct: 133 PPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPP 175 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 668 GXXXXXPPPPXPXXKKXXPPPPPP 739 G PPPP + PPPPPP Sbjct: 14 GNYPQGPPPPVGVPPQYYPPPPPP 37 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P K PPPPPP Sbjct: 107 PPPPPP---KPQPPPPPP 121 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 687 PPXPPPXXKKXXPPPPP 737 P PPP K PPPPP Sbjct: 104 PKRPPPPPPKPQPPPPP 120 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 29.9 bits (64), Expect = 2.9 Identities = 23/76 (30%), Positives = 24/76 (31%), Gaps = 1/76 (1%) Frame = +3 Query: 513 GGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXX-PP 689 GG P P G F G PP + PP P P GG PP Sbjct: 154 GGVPSGPPSGARPIGF-GSPPPMGPGM-SMPPPSGMPGGPLSNGPPPSGMHGGHLSNGPP 211 Query: 690 PXPPPXXKKXXPPPPP 737 P P PPPP Sbjct: 212 PSGMPGGPLSNGPPPP 227 >At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 147 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/59 (28%), Positives = 18/59 (30%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXP 698 PPPP GG + PP PPP P G PPP P Sbjct: 53 PPPPSSSGGGGSYYYSPPPPSSS--GGVKYPPPYGGDGYGGYYPPPYYGNYGTPPPPNP 109 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKK---XXPPPPP 737 PPP P P P PPP KK PPPPP Sbjct: 227 PPPQVKQSEPTPPPPPPSIAVKQSAPTPSPPPPIKKGSSPSPPPPP 272 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP PPPPPP Sbjct: 256 PPPPIKKGSSPSPPPPPP 273 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 4/48 (8%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPX----PPPXXKKXXPPPPP 737 PPPPP PPP PPP PPPPP Sbjct: 347 PPPPPNRAAFQAITQEKSPVPPPRRSPPPLQTPPPPPPPPPLAPPPPP 394 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/60 (28%), Positives = 18/60 (30%), Gaps = 2/60 (3%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPPXXXS--XXKXXXXGGXXXXXXPPXXXXXFXFXXXPXPPPXXP 857 PPP P PPPPP S P + F P PPP P Sbjct: 55 PPPSPSLPLSSSPPPPPPHKHSPPPLSQSLSPPPLITVIHPPPPRFYYFESTPPPPPLSP 114 >At5g06640.1 68418.m00750 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 689 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 312 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 369 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 370 SPKVDYKSPPPPYVYS 385 Score = 28.3 bits (60), Expect = 8.8 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP ++ PPP P P PP P Sbjct: 412 PPPPYYSPSPKVAYKSPPPP--YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 469 Query: 702 PXXKKXXPPPPPXXXS 749 + PPPP S Sbjct: 470 SPKVEYKSPPPPYVYS 485 >At5g06630.1 68418.m00749 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 440 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 313 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPNVYYKSPPPPYVYSSPPPPYYSP 370 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 371 SPKVHYKSPPPPYVYS 386 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 338 PPPPYYSPSPNVYYKSPPPP--YVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSP 395 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 396 SPKVHYKSPPPPYVYS 411 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 163 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 220 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 221 SPKVYYKSPPPPYVYS 236 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 188 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 245 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 246 SPKVYYKSPPPPYVYS 261 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 213 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 270 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 271 SPKVYYKSPPPPYVYS 286 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 238 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 295 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 296 SPKVYYKSPPPPYVYS 311 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 263 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 320 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 321 SPKVYYKSPPPPYVYS 336 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 288 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 345 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 346 SPNVYYKSPPPPYVYS 361 >At3g54590.1 68416.m06040 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 743 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 480 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 537 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 538 SPKVHYKSPPPPYVYS 553 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 405 PPPPTYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 462 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 463 SPKVYYKSPPPPYVYS 478 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 430 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 487 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 488 SPKVYYKSPPPPYVYS 503 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 455 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 512 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 513 SPKVYYKSPPPPYVYS 528 Score = 29.1 bits (62), Expect = 5.0 Identities = 18/72 (25%), Positives = 21/72 (29%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 505 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSP 562 Query: 702 PXXKKXXPPPPP 737 PPPP Sbjct: 563 SPKVHYKSPPPP 574 Score = 29.1 bits (62), Expect = 5.0 Identities = 21/78 (26%), Positives = 24/78 (30%), Gaps = 2/78 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP--PPPPXXXXXXXXPXXXXGGXXXXPPPX 695 PPPP + PP ++ PPP P P P PPP Sbjct: 580 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVYYKSPPPPYVYSS---PPPPY 634 Query: 696 PPPXXKKXXPPPPPXXXS 749 P K PPP S Sbjct: 635 YSPSPKVYYKSPPPPYYS 652 Score = 28.7 bits (61), Expect = 6.6 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP ++ PPP P P PP P Sbjct: 330 PPPPYYSPSPKVDYKSPPPP--YVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSP 387 Query: 702 PXXKKXXPPPPPXXXS 749 + PPPP S Sbjct: 388 SPKVEYKSPPPPYVYS 403 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 29.5 bits (63), Expect = 3.8 Identities = 23/77 (29%), Positives = 23/77 (29%), Gaps = 5/77 (6%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPP---PPPXXXXXXXXPXXXXGGXXXXPPP 692 PPPP PP P PP PPP P PPP Sbjct: 83 PPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVS----PPPP 138 Query: 693 XPPPXXKKXXPP--PPP 737 P P PP PPP Sbjct: 139 TPTPSVPSPTPPVSPPP 155 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPP P P PP PPP P PP Sbjct: 153 PPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPP 196 Score = 29.1 bits (62), Expect = 5.0 Identities = 21/83 (25%), Positives = 21/83 (25%) Frame = +3 Query: 609 PPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXXX 788 PPPP P P P P PPP P P P S Sbjct: 153 PPPPTPTPSVPSPTPPVPTD-----PMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSV 207 Query: 789 XXPPXXXXXFXFXXXPXPPPXXP 857 PP P PP P Sbjct: 208 PSPPDVTPTPPTPSVPSPPDVTP 230 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/46 (32%), Positives = 15/46 (32%), Gaps = 2/46 (4%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPP--PPP 737 PP P PP PPP P P PP PPP Sbjct: 74 PPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPP 119 >At2g34670.1 68415.m04259 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 561 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 687 PPXPPPXXKKXXPPPPP 737 PP PPP PPPPP Sbjct: 75 PPSPPPTLPPSPPPPPP 91 >At2g24980.1 68415.m02987 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 559 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 457 PPPPYYSPSPKVYYKSPPP--SYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSP 514 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 515 SPKVYYKSPPPPYVYS 530 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/72 (25%), Positives = 21/72 (29%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 482 PPPPYYSPSPKVYYKSPPP--SYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 539 Query: 702 PXXKKXXPPPPP 737 PPPP Sbjct: 540 SPKVTYKSPPPP 551 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 182 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 239 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 240 SPKVYYKSPPPPYVYS 255 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 207 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 264 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 265 SPKVYYKSPPPPYVYS 280 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 232 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 289 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 290 SPKVYYKSPPPPYVYS 305 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 257 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 314 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 315 SPKVYYKSPPPPYVYS 330 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 282 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 339 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 340 SPKVYYKSPPPPYVYS 355 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 307 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 364 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 365 SPKVYYKSPPPPYVYS 380 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 357 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVYYKSPPPPYVYNSPPPPYYSP 414 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 415 SPKVYYKSPPPPYVYS 430 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP + PP ++ PPP P P PP P Sbjct: 382 PPPPYYSPSPKVYYKSPPPP--YVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 439 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 440 SPKVYYKSPPPPYVYS 455 Score = 28.7 bits (61), Expect = 6.6 Identities = 20/74 (27%), Positives = 23/74 (31%), Gaps = 2/74 (2%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPP--PPPPXXXXXXXXPXXXXGGXXXXPPPX 695 PPPP + PP ++ PPP P P P PPP Sbjct: 332 PPPPYYSPSPKVYYKSPPPP--YVYSSPPPPYYSPSPKVYYKSPPPPYVYSS---PPPPY 386 Query: 696 PPPXXKKXXPPPPP 737 P K PPP Sbjct: 387 YSPSPKVYYKSPPP 400 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -2 Query: 738 GGGGGGXFFFXXGXGGGG 685 GGGGGG ++ G GGGG Sbjct: 96 GGGGGGGGWYKWGCGGGG 113 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -2 Query: 738 GGGGGGXFFFXXGXGGGG 685 GGGGGG + + G GGGG Sbjct: 86 GGGGGGGWGWGGGGGGGG 103 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/42 (30%), Positives = 13/42 (30%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPP 731 PPPPPP P P PP PPP Sbjct: 68 PPPPPPSSSPLSSLSPSLSPSPPSSSPSSAPPSSLSPSSPPP 109 >At1g07310.1 68414.m00778 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 352 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/59 (28%), Positives = 18/59 (30%), Gaps = 5/59 (8%) Frame = +3 Query: 576 PXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKK-----XXPPPPP 737 P + PPPPPPP P P P P PPPPP Sbjct: 161 PQGNHYYSPSPPPPPPPQAPITAPSPQRDYREFSQSPSPSPYAFTDHYYSGYYYPPPPP 219 >At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP P PPPPPP Sbjct: 105 PPPFPGPYDSAPPPPPP 121 >At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP P PPPPPP Sbjct: 105 PPPFPGPYDSAPPPPPP 121 >At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP P PPPPPP Sbjct: 105 PPPFPGPYDSAPPPPPP 121 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 P PPP P P PPP KK PPPP Sbjct: 126 PSPPPTPSLPPPAPKKSPS-----TPSLPPPTPKKSPPPPP 161 >At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 341 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPP P Sbjct: 23 PPPPPPPPSSSLPPPPLP 40 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPP P Sbjct: 23 PPPPPPPPSSSLPPPPLP 40 >At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 388 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPP P Sbjct: 23 PPPPPPPPSSSLPPPPLP 40 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PPPP P Sbjct: 23 PPPPPPPPSSSLPPPPLP 40 >At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 135 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 684 PPPXPPPXXKKXXPPPPP 737 PPP PPP PPP P Sbjct: 38 PPPPPPPPPLSLSPPPSP 55 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 1/56 (1%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPP-PXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP K PP P P P P P P P P K P P P Sbjct: 28 PPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTP 83 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 1/56 (1%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPP-PXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP K PP P P P P P P P P K P P P Sbjct: 39 PPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTP 94 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 1/56 (1%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPP-PXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP K PP P P P P P P P P K P P P Sbjct: 61 PPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAP 116 >At5g53060.1 68418.m06592 KH domain-containing protein Length = 652 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -1 Query: 736 GGGGGXXFFXXGGGXGGG 683 GGGGG + GGG GGG Sbjct: 36 GGGGGNNRYRGGGGGGGG 53 >At5g25550.1 68418.m03040 leucine-rich repeat family protein / extensin family protein similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana]; contains Pfam PF00560: Leucine Rich Repeat domains Length = 433 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPP P PPPPPP Sbjct: 408 PPPARPCPPVYSPPPPPP 425 >At5g10060.1 68418.m01165 expressed protein Length = 469 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/53 (30%), Positives = 18/53 (33%) Frame = +3 Query: 576 PXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 P + + P PPPP G PP PPP PPPP Sbjct: 384 PTTQGQYHVIPNPPPPQFLKPPVMNNPYAFGNIPLMPPGLPPP------PPPP 430 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/59 (30%), Positives = 19/59 (32%), Gaps = 1/59 (1%) Frame = -1 Query: 856 GXXGGGXGXXXKXXXXXXXGGXXXXXXPPXXFXXXXXXXXGG-GGGXXFFXXGGGXGGG 683 G GGG G G P GG GGG + GGG GGG Sbjct: 109 GGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGGGGGYGGGGGYGGG 167 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -1 Query: 736 GGGGGXXFFXXGGGXGGG 683 GGGGG + GGG GGG Sbjct: 122 GGGGGYSYGGGGGGYGGG 139 >At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, putative strong similarity to L-galactono-1,4-lactone dehydrogenase, Brassica oleracea, Z97060 [gi:2760543], and gi:3986289 from Ipomea batatas Length = 610 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 669 GXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGG 776 G PPP PPP PPPPP S + G Sbjct: 39 GQTLTPPPPPPPRP----PPPPPATASEAQFRKYAG 70 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPP 734 PPP P P PP PP K PPPP Sbjct: 84 PPPTPIYPPPVAFPPPQAYQAYYYRKSPPPPPSKYGKVYPPPP 126 >At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 359 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 689 PPPXPXXKKXXPPPPPP 739 PPP P PPPPPP Sbjct: 24 PPPPPYYYLDPPPPPPP 40 >At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 177 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 686 PPPPXPXXKKXXPPPPPP 739 PPPP P PP PPP Sbjct: 126 PPPPYPRQVHPQPPAPPP 143 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -1 Query: 736 GGGGGXXFFXXGGGXGGG 683 GGGGG + GGG GGG Sbjct: 160 GGGGGGRYGSGGGGGGGG 177 Score = 28.3 bits (60), Expect = 8.8 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 738 GGGGGGXFFFXXGXGGGG 685 GGGGGG + G GGGG Sbjct: 160 GGGGGGRYGSGGGGGGGG 177 >At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family protein Length = 558 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 615 PPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PP P P G P PP PPPPP Sbjct: 230 PPTPPLPKFLVSPASSLGKRDENSSPFAPPTPPPPPPPPPP 270 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GGG GG G GGG G GGGGGG Sbjct: 45 GGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGG 88 >At1g29230.1 68414.m03575 CBL-interacting protein kinase 18 (CIPK18) identical to CBL-interacting protein kinase 18 [Arabidopsis thaliana] gi|14334388|gb|AAK59695 Length = 520 Score = 25.0 bits (52), Expect(2) = 7.4 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPP 626 PP PPPPPPP Sbjct: 8 PPLVVTTVVPDPPPPPPP 25 Score = 21.8 bits (44), Expect(2) = 7.4 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 684 PPPXPPPXXK 713 PPP PPP K Sbjct: 20 PPPPPPPHPK 29 >At3g51710.1 68416.m05670 curculin-like (mannose-binding) lectin family protein / PAN domain-containing protein contains Pfam profiles: PF01453 lectin (probable mannose binding), PF00024 PAN domain Length = 476 Score = 25.8 bits (54), Expect(2) = 7.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 582 KKXIFXXXPPPPPPP 626 +K + PPPPPPP Sbjct: 452 RKSLLLPPPPPPPPP 466 Score = 21.0 bits (42), Expect(2) = 7.5 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +3 Query: 684 PPPXPPPXXKKXXP 725 PPP PPP P Sbjct: 458 PPPPPPPPPLSQQP 471 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GG GGG + G GGG GGGGGG Sbjct: 215 GGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGG 258 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -3 Query: 737 GGGGGGXFFXXXGXXGGGXXXPPPPXXXGXXXXXXXXXGGGGGG 606 GGG G + G GGG P G GGG GG Sbjct: 320 GGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGGMGG 363 >At4g03120.1 68417.m00425 proline-rich family protein similar to U1 small nuclear ribonucleoprotein C; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 207 Score = 28.3 bits (60), Expect = 8.8 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 5/49 (10%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXP-----PPXXKKXXPPPPP 737 PPPP P GG P P PP PPPPP Sbjct: 127 PPPPQNGILRPPGMAPIPGQGGGPPGMAPIPGQGGGPPPNYNGLPPPPP 175 >At3g28630.2 68416.m03574 expressed protein contains Pfam profile: PF04601 protein of unknown function (DUF569 Length = 303 Score = 28.3 bits (60), Expect = 8.8 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPP 626 PP + + PPPPPPP Sbjct: 154 PPVAEPAYTPLPPPPPPP 171 >At3g28630.1 68416.m03573 expressed protein contains Pfam profile: PF04601 protein of unknown function (DUF569 Length = 335 Score = 28.3 bits (60), Expect = 8.8 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 573 PPXKKXIFXXXPPPPPPP 626 PP + + PPPPPPP Sbjct: 186 PPVAEPAYTPLPPPPPPP 203 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 28.3 bits (60), Expect = 8.8 Identities = 19/76 (25%), Positives = 21/76 (27%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP ++ PPP P P PP P Sbjct: 639 PPPPCYSPSPKVVYKSSPPP--YVYSSPPPPYHSPSPKVHYKSPPPPYVYSSPPPPYYSP 696 Query: 702 PXXKKXXPPPPPXXXS 749 PPPP S Sbjct: 697 SPKVHYKSPPPPYVYS 712 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 28.3 bits (60), Expect = 8.8 Identities = 22/79 (27%), Positives = 22/79 (27%) Frame = +3 Query: 513 GGXPPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPP 692 G PP P PP I PPPP P P Sbjct: 82 GSSPPSPTDSSSSTSI-SPNPPAP--IVNPNPPPPSTPNPPPEFSPPPPDLD----TTTA 134 Query: 693 XPPPXXKKXXPPPPPXXXS 749 PPP PPPPP S Sbjct: 135 PPPPSTDIPIPPPPPAPVS 153 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 28.3 bits (60), Expect = 8.8 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPPPP PPP + PPPPP Sbjct: 257 PPPPPPQVYQTQPPSWPSQPQQHSMVPPPMQFRPPQGMPPPPPP 300 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 28.3 bits (60), Expect = 8.8 Identities = 13/42 (30%), Positives = 13/42 (30%) Frame = +3 Query: 612 PPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPP 737 PPPP P G P P PPPPP Sbjct: 37 PPPPQQHSQPPVAPLVPPGPPYAPPAQIPSSLLPTNLPPPPP 78 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 28.3 bits (60), Expect = 8.8 Identities = 19/71 (26%), Positives = 20/71 (28%) Frame = +3 Query: 525 PPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPP 704 PPP G PP P P PPP P P PPP Sbjct: 71 PPPEPSPPSPSLTG--PPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPP 128 Query: 705 XXKKXXPPPPP 737 + PP P Sbjct: 129 PTE--APPTTP 137 Score = 28.3 bits (60), Expect = 8.8 Identities = 20/84 (23%), Positives = 22/84 (26%) Frame = +3 Query: 606 PPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPPPXXKKXXPPPPPXXXSXXKXXXXGGXXX 785 PP P PP P P P PPP + PP P + Sbjct: 72 PPEPSPPSPSLTGPPPTTIPVSPPPEPSP-PPPLPTEAPPPANPVSSPPPESSPPPPPPT 130 Query: 786 XXXPPXXXXXFXFXXXPXPPPXXP 857 P P PPP P Sbjct: 131 EAPPTTPITSPSPPTNPPPPPESP 154 Score = 28.3 bits (60), Expect = 8.8 Identities = 17/58 (29%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = +3 Query: 573 PPXKKXIFXXXPP--PPPPPXXXXXXXXPXXXXG-GXXXXPPPXPPPXXKKXXPPPPP 737 PP + P PPPPP P PPP PP PP P Sbjct: 109 PPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNP 166 Score = 28.3 bits (60), Expect = 8.8 Identities = 17/70 (24%), Positives = 18/70 (25%) Frame = +3 Query: 522 PPPPXXGGGXXXFXGXXPPXKKXIFXXXPPPPPPPXXXXXXXXPXXXXGGXXXXPPPXPP 701 PPPP PP PP P P P P P Sbjct: 126 PPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPS 185 Query: 702 PXXKKXXPPP 731 P + PPP Sbjct: 186 PPASEIPPPP 195 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,790,724 Number of Sequences: 28952 Number of extensions: 331700 Number of successful extensions: 12335 Number of sequences better than 10.0: 150 Number of HSP's better than 10.0 without gapping: 887 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4610 length of database: 12,070,560 effective HSP length: 82 effective length of database: 9,696,496 effective search space used: 2530785456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -