BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_B07 (919 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. 26 1.8 AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. 26 1.8 AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. 26 1.8 AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. 26 1.8 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 26 1.8 AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection... 23 9.8 >AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.8 bits (54), Expect = 1.8 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -3 Query: 323 CSAFMSFVTIFLECPDGSKWLVCSDAXXLVRC 228 CS SF F E DG + +CS +RC Sbjct: 47 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 78 >AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.8 bits (54), Expect = 1.8 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -3 Query: 323 CSAFMSFVTIFLECPDGSKWLVCSDAXXLVRC 228 CS SF F E DG + +CS +RC Sbjct: 47 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 78 >AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.8 bits (54), Expect = 1.8 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -3 Query: 323 CSAFMSFVTIFLECPDGSKWLVCSDAXXLVRC 228 CS SF F E DG + +CS +RC Sbjct: 47 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 78 >AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.8 bits (54), Expect = 1.8 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -3 Query: 323 CSAFMSFVTIFLECPDGSKWLVCSDAXXLVRC 228 CS SF F E DG + +CS +RC Sbjct: 47 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 78 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 25.8 bits (54), Expect = 1.8 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -3 Query: 323 CSAFMSFVTIFLECPDGSKWLVCSDAXXLVRC 228 CS SF F E DG + +CS +RC Sbjct: 623 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 654 >AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection responsive shortpeptide protein. Length = 81 Score = 23.4 bits (48), Expect = 9.8 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +3 Query: 405 CQTKGGRYCGY 437 C++ G RYCGY Sbjct: 32 CKSIGARYCGY 42 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 709,412 Number of Sequences: 2352 Number of extensions: 13895 Number of successful extensions: 23 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 99641691 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -