BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_B07 (919 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 29 4.3 At2g42670.1 68415.m05281 expressed protein 28 7.5 At4g12820.1 68417.m02010 F-box family protein similar to F-box p... 28 10.0 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +3 Query: 267 LRSVRAFEKDRHETHERRAQQEDFKHQTLDGLLINKQLW 383 + S RAF + R+ +++ QQ+ F T GL+ LW Sbjct: 127 INSQRAFNEIRYRHMQQQEQQQHFHFTTARGLVSGHSLW 165 >At2g42670.1 68415.m05281 expressed protein Length = 241 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +3 Query: 288 EKDRHETHERRAQQEDFKHQ-TLDGLLINKQLWLAE 392 E DRH T+ R++++ED + +DG ++ WL E Sbjct: 185 EHDRHCTYFRKSRREDLPGELEVDGEVVTDVTWLEE 220 >At4g12820.1 68417.m02010 F-box family protein similar to F-box protein family, AtFBX7 (GI:20197899) [Arabidopsis thaliana] Length = 442 Score = 27.9 bits (59), Expect = 10.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 391 SASHSCLLISNPSSVWCL 338 SAS SCL + NP+S W + Sbjct: 96 SASESCLAVKNPTSPWII 113 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,494,245 Number of Sequences: 28952 Number of extensions: 277888 Number of successful extensions: 555 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 555 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2178500352 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -