BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_B02 (941 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY035716-1|AAK61362.1| 136|Anopheles gambiae histone 3A protein. 276 8e-76 Y09952-1|CAA71083.1| 115|Anopheles gambiae histone H3 protein. 226 7e-61 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 7.7 >AY035716-1|AAK61362.1| 136|Anopheles gambiae histone 3A protein. Length = 136 Score = 276 bits (676), Expect = 8e-76 Identities = 136/136 (100%), Positives = 136/136 (100%) Frame = +2 Query: 164 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 343 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60 Query: 344 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 523 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120 Query: 524 MPKDIQLARRIRGERA 571 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 >Y09952-1|CAA71083.1| 115|Anopheles gambiae histone H3 protein. Length = 115 Score = 226 bits (553), Expect = 7e-61 Identities = 110/115 (95%), Positives = 113/115 (98%) Frame = +2 Query: 170 RTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELL 349 RTKQTARKSTGGKAPRKQLA KAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELL Sbjct: 1 RTKQTARKSTGGKAPRKQLARKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELL 60 Query: 350 IRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKR 514 IRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKR Sbjct: 61 IRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 115 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 7.7 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -2 Query: 427 GRLETQISFEILSDFSHKTLERQLTDKQLSRLLITTNFTKGHCTRA 290 G + T +F +LSD + L TD QLS + + N +A Sbjct: 803 GTITTGSAFVLLSDKTSLRLITTTTDHQLSEVELRPNLPANFVVKA 848 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 771,018 Number of Sequences: 2352 Number of extensions: 13118 Number of successful extensions: 21 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 102949299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -