SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP02_F_B01
         (862 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC3F10.05c |mug113||DUF1766 family protein|Schizosaccharomyces...    26   6.0  

>SPAC3F10.05c |mug113||DUF1766 family protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 326

 Score = 26.2 bits (55), Expect = 6.0
 Identities = 10/31 (32%), Positives = 18/31 (58%)
 Frame = -3

Query: 638 K*CLILV*NDRFIYSIKNDRLSWVENFKCDN 546
           K C +    +R ++   N+ LSW++ F CD+
Sbjct: 261 KPCQVSFKVERLVHKELNEYLSWMQPFTCDS 291


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,638,746
Number of Sequences: 5004
Number of extensions: 47639
Number of successful extensions: 92
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 90
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 92
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 428468660
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -