BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_B01 (862 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 23 4.8 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 22 8.4 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 22.6 bits (46), Expect = 4.8 Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -2 Query: 741 QCSIVEQASI*PCITWLSDDLNSFTIL--NVTFN 646 QC + Q I I W+ +L + IL N T N Sbjct: 62 QCDLSNQNDILKVIEWVEKNLGAIDILINNATIN 95 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.8 bits (44), Expect = 8.4 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -3 Query: 506 YILREIIKKMSCIVFTYTALLIYFEIDADY 417 Y+ I + C VF + ALL Y ++ Y Sbjct: 300 YVKAIDIYLVMCFVFVFAALLEYAAVNYTY 329 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,654 Number of Sequences: 438 Number of extensions: 3448 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27795333 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -