BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_A24 (877 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 26 1.3 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 26 1.7 AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. 25 2.3 AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CY... 25 4.0 AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein ... 24 7.0 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 26.2 bits (55), Expect = 1.3 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 572 VHSITMAMMNMQSSFVWLVVNVXSTLNSNDIESTDRAK 685 V + T +NM+SS VWL+V T+ S + E R K Sbjct: 6 VRTSTTHGINMRSSSVWLIVVCAVTVASANSEELLRGK 43 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 25.8 bits (54), Expect = 1.7 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +1 Query: 220 YRLVQEDSDLISDRDETGAYL 282 Y+L +E DL +DR+ETG +L Sbjct: 770 YQLAEELLDLPNDRNETGLHL 790 >AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. Length = 194 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 400 CCRILLLREPLLQQYHC*SP 341 CCR LRE LQ HC P Sbjct: 142 CCRESFLRERQLQLTHCYDP 161 >AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CYP6M1 protein. Length = 503 Score = 24.6 bits (51), Expect = 4.0 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +1 Query: 85 DFMEENIQKFNN-ERRSSKQWVKLNVGGTYFLTTKTTLCRDPNS 213 DFMEEN+QK E + +V GT + RDP++ Sbjct: 161 DFMEENVQKHGEMELKDVMARFTTDVIGTCAFGIECNSMRDPDA 204 >AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein S26 protein. Length = 114 Score = 23.8 bits (49), Expect = 7.0 Identities = 9/37 (24%), Positives = 21/37 (56%) Frame = -3 Query: 719 ELTFVSLFAATLLHDLLTQCHYC*VYXTHSRLTTQRN 609 +++ S++++ +L L + HYC HS++ R+ Sbjct: 51 DISDASVYSSYVLPKLYAKLHYCVSCAIHSKVVRNRS 87 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 850,466 Number of Sequences: 2352 Number of extensions: 16644 Number of successful extensions: 80 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 93853377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -