BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_A21 (890 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A4HF62 Cluster: Putative uncharacterized protein; n=1; ... 34 4.2 >UniRef50_A4HF62 Cluster: Putative uncharacterized protein; n=1; Leishmania braziliensis|Rep: Putative uncharacterized protein - Leishmania braziliensis Length = 1539 Score = 34.3 bits (75), Expect = 4.2 Identities = 25/65 (38%), Positives = 30/65 (46%), Gaps = 6/65 (9%) Frame = +3 Query: 57 SGSAAGLCQGYPRATRPPQ------HVAGVAWARCXGRRRPATSLGLWTGRATDVTRLDD 218 S SAA C RP Q + + A RRR +S+G TGR +D T L Sbjct: 570 SSSAAAACAAASVICRPSQTCTRDSYKTSASVAPATSRRRKNSSVG--TGRGSDTTTLKR 627 Query: 219 SRPDK 233 SRPDK Sbjct: 628 SRPDK 632 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 582,049,512 Number of Sequences: 1657284 Number of extensions: 10240676 Number of successful extensions: 23507 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 22790 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23504 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 80342087756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -