BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_A19 (953 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81544-6|CAI46607.1| 376|Caenorhabditis elegans Hypothetical pr... 29 6.5 Z92829-7|CAB07347.1| 284|Caenorhabditis elegans Hypothetical pr... 28 8.6 >Z81544-6|CAI46607.1| 376|Caenorhabditis elegans Hypothetical protein F49C5.9 protein. Length = 376 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +3 Query: 105 GPVITNYGIPVIISARIMLIYFVKNKILFLF 197 GP NY + + +S+ ++L+YF+ +L F Sbjct: 100 GPFAINYRVTLYLSSTVVLLYFMPTMLLLSF 130 >Z92829-7|CAB07347.1| 284|Caenorhabditis elegans Hypothetical protein F10A3.11 protein. Length = 284 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/46 (32%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 68 KRCSEFAGHTGLRSRDYQLWNTSYYK--CENHVNLFCEK*NFIFIC 199 K E GH + S D +W+ Y K C N +F N F+C Sbjct: 107 KWIDEAGGHENIISSDGNIWSVEYNKFVCTNGTRMFLR--NSTFVC 150 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,563,757 Number of Sequences: 27780 Number of extensions: 193742 Number of successful extensions: 398 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 398 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2475644248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -