BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_A17 (947 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 136 2e-32 SB_35724| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 4e-24 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 3e-21 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 92 5e-19 SB_38053| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_7309| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_1903| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_34414| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_45109| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-09 SB_51245| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_54507| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_58426| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_57366| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_56245| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_55566| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_55077| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_53790| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_52894| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_48533| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_47211| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_46066| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_43715| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_42865| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_41269| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_40020| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_38531| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_35148| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_31008| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_30985| Best HMM Match : DUF1450 (HMM E-Value=1.5) 56 6e-08 SB_29391| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_24808| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_23019| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_21707| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_19542| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_19098| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_19031| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_17805| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_15695| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_12040| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_9760| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_5267| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_3766| Best HMM Match : Moricin (HMM E-Value=5.1) 56 6e-08 SB_1707| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_1382| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_1275| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 4e-07 SB_27738| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 7e-07 SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 7e-07 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 50 2e-06 SB_52929| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_25376| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_58224| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55737| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54286| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54219| Best HMM Match : Toxin_8 (HMM E-Value=8.1) 44 1e-04 SB_41217| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38325| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17471| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16089| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9623| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_59708| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_59685| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_59589| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_59479| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58142| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57899| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57889| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57793| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57693| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57320| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55905| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55790| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55716| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55631| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55333| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55090| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54702| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54683| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54384| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53884| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53624| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53241| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52402| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_51349| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_51271| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50626| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49587| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49375| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49357| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49260| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49181| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48829| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48601| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48323| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48037| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47484| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47382| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47359| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47312| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46998| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46785| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46606| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46553| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46274| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46222| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46158| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45670| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45556| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45238| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44797| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44462| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43465| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42828| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42781| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42533| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42195| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41845| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40938| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39214| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38586| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38311| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37725| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37267| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37229| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_36145| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_35184| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_34961| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_34855| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_34644| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_34569| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33632| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33419| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33059| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_32948| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_32667| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_32556| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_31680| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_31259| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30530| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30465| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30185| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_29900| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_29015| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_28377| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_28369| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_28136| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_27976| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_27792| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_27734| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26258| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26165| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_25748| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_25006| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24933| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24744| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24530| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_23602| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_23082| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_23076| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22933| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22408| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22371| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21708| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21671| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21133| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21107| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_20737| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_20572| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19574| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19433| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_18666| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17812| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17809| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17259| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17176| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16930| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16732| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16453| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_15769| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_15576| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_15019| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14967| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14861| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14376| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14280| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14068| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12970| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12483| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12400| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_11534| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_11286| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_11221| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_10946| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_10173| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9717| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9609| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9186| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9181| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8946| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8892| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8840| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8665| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8650| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8602| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8412| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8098| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7942| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7762| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7701| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_6381| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5634| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5583| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5352| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4816| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4803| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4739| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4616| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4498| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4379| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_3983| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_3821| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_3004| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2988| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2927| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2917| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2901| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2472| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2187| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2000| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1929| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1735| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1566| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1545| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1521| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1469| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1412| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1338| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1265| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_756| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_338| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_305| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_300| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_251| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 41 0.001 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_49591| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 39 0.005 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_41802| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_34775| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_32513| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_32393| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_29655| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_26089| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_24699| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_24687| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_15282| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_6708| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_2276| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_59347| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 39 0.005 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 39 0.005 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_29950| Best HMM Match : A2M_comp (HMM E-Value=7.1) 38 0.009 SB_2327| Best HMM Match : HTH_1 (HMM E-Value=6.1e-11) 38 0.016 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 37 0.021 SB_55951| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_55453| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_51471| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_46397| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_27300| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_21455| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_20356| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_16282| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_6959| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_6102| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 37 0.027 SB_5610| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_2852| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_2781| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_45889| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_45032| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 37 0.027 SB_43474| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_42098| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_39127| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_25846| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_23237| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_21710| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_10421| Best HMM Match : Guanylate_cyc (HMM E-Value=0) 34 0.19 SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) 33 0.34 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_55059| Best HMM Match : Orn_Arg_deC_N (HMM E-Value=0) 29 7.3 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 136 bits (330), Expect = 2e-32 Identities = 67/100 (67%), Positives = 70/100 (70%) Frame = +2 Query: 128 RPRLLHFSIGSAPLXEHHKNRRSSQRWRNPTGL*RYQAFPPGKLPRCALLFRPCRLPDTC 307 RPR FSIGSAPL K + + FP + P CALLFRPCRLPDTC Sbjct: 108 RPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPL-EAPSCALLFRPCRLPDTC 166 Query: 308 PPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTNPPXQP 427 PPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTNPP P Sbjct: 167 PPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTNPPFSP 206 Score = 84.6 bits (200), Expect = 1e-16 Identities = 55/105 (52%), Positives = 57/105 (54%), Gaps = 2/105 (1%) Frame = +3 Query: 165 PXTSITKIDAQVRGGETRQDYKDTRRFXXXXXXXXXXXXXXXXYRIPVRLSPFGKRGAFS 344 P TSITKIDAQVRGGETRQDYKDTRRF R+P PF R A+ Sbjct: 120 PLTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCALLFRPC---RLPDTCPPFSLREAWR 176 Query: 345 *LTL*VSQFGVG-RSLQAGLCART-PRFSPTAAPYPVXIVLSPTR 473 L V RS T P FSPTAAPYPV IVLSPTR Sbjct: 177 FLIAHAVGISVRCRSFAPSWAVCTNPPFSPTAAPYPVTIVLSPTR 221 >SB_35724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 109 bits (261), Expect = 4e-24 Identities = 62/89 (69%), Positives = 64/89 (71%), Gaps = 3/89 (3%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAATGNRISRARYVXGATEFL---XVVAYLRA 583 PP QPDRCALSG YRLESNPVRHDLSPLAAATGNRISRARYV GATEFL Y R Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHDLSPLAAATGNRISRARYVGGATEFLKWWPNYGYTRR 71 Query: 584 TLXXQYXGICASAEASYXPEKELVALDPA 670 T+ GICA + KELVALDPA Sbjct: 72 TV----FGICALLKPVTF-GKELVALDPA 95 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 99 bits (238), Expect = 3e-21 Identities = 46/49 (93%), Positives = 46/49 (93%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAATGNRISRARYVXGATEFL 559 PP QPDRCALSG YRLESNPVRHDLSPLAAATGNRISRARYV GATEFL Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHDLSPLAAATGNRISRARYVGGATEFL 60 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 92.3 bits (219), Expect = 5e-19 Identities = 50/96 (52%), Positives = 56/96 (58%) Frame = +2 Query: 128 RPRLLHFSIGSAPLXEHHKNRRSSQRWRNPTGL*RYQAFPPGKLPRCALLFRPCRLPDTC 307 RPR FSIGSAPL K + + FP + P CALLFRPCRLPDTC Sbjct: 137 RPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPL-EAPSCALLFRPCRLPDTC 195 Query: 308 PPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTNP 415 PPFSLREAWRFLIAHAV I ++F S + P Sbjct: 196 PPFSLREAWRFLIAHAVAIRTAKKTFQGSTSSMAAP 231 >SB_38053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 69.3 bits (162), Expect = 4e-12 Identities = 34/54 (62%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = +2 Query: 362 ISVRCRSFAPSWAVCTN-PPXQPDRCALSGXYRLESNPVRHDLSPLAAATGNRI 520 + V+C+ S C + PP QPDRCALSG YRLESNP R DLSPL ATGNRI Sbjct: 46 VIVKCKCSMMSNLGCVHEPPVQPDRCALSGNYRLESNPGRPDLSPLGTATGNRI 99 >SB_7309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 68.1 bits (159), Expect = 1e-11 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP QPDRCALSG YRLESNPVRHDLSPLAAAT Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHDLSPLAAAT 43 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_1903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 68.1 bits (159), Expect = 1e-11 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP QPDRCALSG YRLESNPVRHDLSPLAAAT Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHDLSPLAAAT 43 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 66.5 bits (155), Expect = 3e-11 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 506 WLLPVAISRVLPGWTQDDXYRIRRSGRAEXG 414 WLLPVAISRVLPGWTQDD YRIRRSGRAE G Sbjct: 1 WLLPVAISRVLPGWTQDDSYRIRRSGRAERG 31 >SB_34414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 65.7 bits (153), Expect = 5e-11 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP QPDRCALSG YRLES PVRHDLSPLAAAT Sbjct: 12 PPVQPDRCALSGNYRLESKPVRHDLSPLAAAT 43 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_45109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 55.6 bits (128), Expect(2) = 6e-09 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 139 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 170 Score = 23.0 bits (47), Expect(2) = 6e-09 Identities = 14/43 (32%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +2 Query: 182 KNRRSSQRWRNPTGL*RYQ-AFPPGKLPRCALLFRPCRLPDTC 307 K R + R+R P G RYQ FP + + P D C Sbjct: 104 KGRNQAYRYRRPRGGARYQLLFPLAVRSKLDCMHEPPVQSDRC 146 >SB_51245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 56.0 bits (129), Expect = 4e-08 Identities = 27/42 (64%), Positives = 28/42 (66%) Frame = +2 Query: 383 FAPSWAVCTNPPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 FA PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 3 FASKLDCMHEPPVQSDRCALSGNYRLESNPERHAKAPLAAAT 44 >SB_54507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 25 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 56 >SB_58426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_57366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_56245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_55566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_55077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_53790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_52894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_48533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_47211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_46066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_43715| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_42865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_41269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_40020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_38531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_35148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_31008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_30985| Best HMM Match : DUF1450 (HMM E-Value=1.5) Length = 599 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 368 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 399 >SB_29391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_24808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_23019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_21707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 32 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 63 >SB_19542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_19098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_19031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_17805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_15695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_12040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_9760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_5267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_3766| Best HMM Match : Moricin (HMM E-Value=5.1) Length = 108 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 76 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 107 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 361 YLSSV*VVRSKLGCVHEPP 417 + V VRSKL C+HEPP Sbjct: 59 FFRGVKAVRSKLDCMHEPP 77 >SB_1707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_1382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_1275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDLSPLAAAT 508 PP Q DRCALSG YRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 52.8 bits (121), Expect = 4e-07 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +3 Query: 165 PXTSITKIDAQVRGGETRQDYKDTRRF 245 P TSITK DAQ+ GGETRQDYKDTRRF Sbjct: 119 PLTSITKSDAQISGGETRQDYKDTRRF 145 >SB_27738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 52.0 bits (119), Expect = 7e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNPVRHDL 487 PP QPDRCALSG YRLESNPVRH L Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHRL 36 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = +1 Query: 379 VVRSKLGCVHEPPXSARPLRLIR*XSS*VQPGKTRLIATGSS 504 VVRSKLGCVHEPP L P + RLIATGSS Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHRLIATGSS 42 >SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 52.0 bits (119), Expect = 7e-07 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = -1 Query: 272 ERIEGAXQGETPGIFIVLSGFATSDLSVDFCDARXGGRSLWK 147 E G+ QGET GIFIVLSGFAT+DLSV F DA GG + K Sbjct: 12 ESARGSRQGETLGIFIVLSGFATTDLSVRFRDACQGGGAYGK 53 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 169 QGGGAYGKMQKPRP 128 QGGGAYGK PRP Sbjct: 46 QGGGAYGKTALPRP 59 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 50.4 bits (115), Expect = 2e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = +3 Query: 165 PXTSITKIDAQVRGGETRQDYKDTRR 242 P TSITK DAQ+ GGETRQDYKDTRR Sbjct: 157 PLTSITKSDAQISGGETRQDYKDTRR 182 >SB_52929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 35 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +2 Query: 425 PDRCALSGXYRLESNPVRHDLSPLAAA 505 PDRCALSG YRLESNP RH +PLAAA Sbjct: 8 PDRCALSGNYRLESNPERHAKAPLAAA 34 >SB_25376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 34 Score = 46.8 bits (106), Expect = 3e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 358 YSVSYEKAPRFPKGERRTGI 299 YSVSYEKAPRFPKGERRTGI Sbjct: 14 YSVSYEKAPRFPKGERRTGI 33 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = -1 Query: 398 PSLERTTYTELRYLQREL*ESATLPEGRK 312 PSLERTTYTELRY ++ P+G + Sbjct: 1 PSLERTTYTELRYYSVSYEKAPRFPKGER 29 >SB_58224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_55737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_54286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_54219| Best HMM Match : Toxin_8 (HMM E-Value=8.1) Length = 75 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 56 PPVQPDRCALSGNYRLESNP 75 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 45 VVRSKLGCVHEPP 57 >SB_41217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_38325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_17471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_16089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_9623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_59708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_59685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_59589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_59479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_58142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_57899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_57889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_57793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_57693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_57320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_55905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_55790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_55716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_55631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_55333| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_55090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_54702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_54683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_54384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_53884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 45 PPVQPDRCALSGNYRLESNP 64 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 34 VVRSKLGCVHEPP 46 >SB_53624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_53241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_52402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_51349| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_51271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_50626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_49587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_49375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_49357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_49260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_49181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_48829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_48601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_48323| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_48037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_47484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_47382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_47359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_47312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_46998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_46785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_46606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_46553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_46274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_46222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_46158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_45670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_45556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_45238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_44797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_44462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_43465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_42828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_42781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_42533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_42195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_41845| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_40938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_39214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_38586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_38311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_37725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_37267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_37229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_36145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_35184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_34961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_34855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_34644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_34569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_33632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_33419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_33059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_32948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_32667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_32556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_31680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_31259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_30530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_30465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_30185| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_29900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_29015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_28377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_28369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_28136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_27976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_27792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_27734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_26258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_26165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_25748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_25006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_24933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_24744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_24530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_23602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_23082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_23076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_22933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_22408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_22371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_21708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_21671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_21133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_21107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_20737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_20572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_19574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_19433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_18666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_17812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_17809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_17259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_17176| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_16930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_16732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_16453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_15769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_15576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_15019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_14967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_14861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_14376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_14280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_14068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_12970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_12483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_12400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_11534| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_11286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_11221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_10946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_10173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_9717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_9609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_9186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_9181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_8946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_8892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_8840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_8665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_8650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_8602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_8412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_8098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_7942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_7762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_7701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_6381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 27 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 8 PPVQPDRCALSGNYRLESNP 27 >SB_5634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_5583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_5352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_4816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_4803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_4739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_4616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_4498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_4379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_3983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_3821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_3004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_2988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_2927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_2917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_2901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_2472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_2187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_2000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_1929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_1735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_1566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_1545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_1521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_1469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_1412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_1338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_1265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_33| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 413 PPXQPDRCALSGXYRLESNP 472 PP QPDRCALSG YRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 VVRSKLGCVHEPP 417 VVRSKLGCVHEPP Sbjct: 1 VVRSKLGCVHEPP 13 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/33 (60%), Positives = 22/33 (66%) Frame = -3 Query: 345 MRKRHASRREKGGQVSGKRQGRNRRAHRGSXPG 247 MRKRHASRREKGGQVSG + G+ PG Sbjct: 1 MRKRHASRREKGGQVSGNSYDHDYEFELGTLPG 33 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/32 (59%), Positives = 21/32 (65%) Frame = -3 Query: 345 MRKRHASRREKGGQVSGKRQGRNRRAHRGSXP 250 MRKRHASRREKGGQVSG + G+ P Sbjct: 1 MRKRHASRREKGGQVSGNSYDHDYEFELGTLP 32 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 345 MRKRHASRREKGGQVSGKR 289 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 345 MRKRHASRREKGGQVSGKR 289 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 345 MRKRHASRREKGGQVSGKR 289 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,967,537 Number of Sequences: 59808 Number of extensions: 446454 Number of successful extensions: 1730 Number of sequences better than 10.0: 363 Number of HSP's better than 10.0 without gapping: 1223 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1709 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2776707833 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -