BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_A11 (861 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 26 0.44 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 25 1.0 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 25 1.0 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 24 1.3 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 24 1.8 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 24 1.8 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 23 3.1 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 7.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.5 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 21 9.5 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 21 9.5 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 21 9.5 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 21 9.5 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 21 9.5 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 25.8 bits (54), Expect = 0.44 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +1 Query: 703 PDHIL-VTEPKDEPVPLRADQRSALPRAXGLC 795 P ++L +T PK EP P D ALP A LC Sbjct: 140 PGNVLNLTMPKYEPNPSIIDPGPALPPAGFLC 171 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 24.6 bits (51), Expect = 1.0 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 470 WNLVPVVVKLLYLASC 517 WNL+P+ V +L A+C Sbjct: 922 WNLLPIAVFILVCATC 937 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 24.6 bits (51), Expect = 1.0 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 470 WNLVPVVVKLLYLASC 517 WNL+P+ V +L A+C Sbjct: 922 WNLLPIAVFILVCATC 937 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +1 Query: 703 PDHIL-VTEPKDEPVPLRADQRSALPRAXGLC 795 P ++L +T PK EP P D ALP LC Sbjct: 140 PGNVLNLTMPKYEPNPSIIDPGPALPPTGFLC 171 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.8 bits (49), Expect = 1.8 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -1 Query: 468 DETENTIASTTYSETSDKLVS*RFGLG 388 DET+N + TY+E +KL LG Sbjct: 340 DETKNHYSKNTYNEQGNKLADLYKSLG 366 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.8 bits (49), Expect = 1.8 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -1 Query: 468 DETENTIASTTYSETSDKLVS*RFGLG 388 DET+N + TY+E +KL LG Sbjct: 232 DETKNHYSKNTYNEQGNKLADLYKSLG 258 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 23.0 bits (47), Expect = 3.1 Identities = 11/23 (47%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = +1 Query: 667 DQQGKNGPKKPQP--DHILVTEP 729 D Q +N PK+P+P D VT P Sbjct: 322 DHQRRNEPKRPRPNIDRHEVTRP 344 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.8 bits (44), Expect = 7.2 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 31 IP*DFEPSPSLFFSAP 78 +P D EP PSLF +P Sbjct: 50 LPLDLEPLPSLFPFSP 65 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 9.5 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 94 VNNISKKRKFVGDGVFKAELNEF 162 VNN S +R+F+ V E N F Sbjct: 1915 VNNPSARRRFIAHVVDFIETNNF 1937 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/24 (37%), Positives = 18/24 (75%) Frame = +1 Query: 94 VNNISKKRKFVGDGVFKAELNEFL 165 +N++ K+R+ V + +FK E++E L Sbjct: 75 LNDLEKRRE-VYESIFKVEVHEAL 97 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/24 (37%), Positives = 18/24 (75%) Frame = +1 Query: 94 VNNISKKRKFVGDGVFKAELNEFL 165 +N++ K+R+ V + +FK E++E L Sbjct: 235 LNDLEKRRE-VYESIFKVEVHEAL 257 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/24 (37%), Positives = 18/24 (75%) Frame = +1 Query: 94 VNNISKKRKFVGDGVFKAELNEFL 165 +N++ K+R+ V + +FK E++E L Sbjct: 235 LNDLEKRRE-VYESIFKVEVHEAL 257 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/29 (31%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -3 Query: 502 QQLHNH--GHQIP**NGEHHSKHDVQRDL 422 Q ++NH GH + + +HH H Q+ + Sbjct: 160 QSMNNHHMGHHMQEQHPQHHQPHHQQQHM 188 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/29 (31%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -3 Query: 502 QQLHNH--GHQIP**NGEHHSKHDVQRDL 422 Q ++NH GH + + +HH H Q+ + Sbjct: 162 QSMNNHHMGHHMQEQHPQHHQPHHQQQHM 190 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,299 Number of Sequences: 336 Number of extensions: 4446 Number of successful extensions: 15 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23866870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -