BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP02_F_A02 (925 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 23 5.2 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 5.2 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 22.6 bits (46), Expect = 5.2 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = +1 Query: 502 GQFIISIFAGFLFGFXGVEWMIGSLDFGFRLLLGVMCALVIALA 633 G I +FA + G L G LLG+ C V+ LA Sbjct: 351 GIIAIGLFADNPYPLNTTNGRKGLLKGGGGYLLGIQCLTVVCLA 394 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.6 bits (46), Expect = 5.2 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = -3 Query: 620 TNAHITPRRRRNPKSKLPIIHSTPXNPKRNPANIEIMNCP 501 ++ H TP + + HSTP PA I+I + P Sbjct: 424 SHIHATPHHHHSHAATPHHQHSTPLAHSSYPAAIQIGHTP 463 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,337 Number of Sequences: 438 Number of extensions: 3560 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 30113811 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -